close

SimulationCraft 801-02

for World of Warcraft 8.0.1 Live (wow build level 27980)

Current simulator hotfixes

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Current simulator-wide DBC data overrides

Spell / Effect Field Override Value DBC Value
Nether Portal duration 15000.00 20000.00
Nether Portal cast_max 0.00 2500.00
Demonic Consumption (effect#1) base_value 3.00 1.00
From the Shadows (effect#1) base_value 50.00 20.00
Bilescourge Bombers (effect#1) sp_coefficient 0.19 0.14
Demonfire (effect#1) sp_coefficient 0.36 0.33
Firebolt (effect#1) sp_coefficient 0.57 0.40
Shadow Bite (effect#1) sp_coefficient 0.51 0.30
Lash of Pain (effect#1) sp_coefficient 0.51 0.30
Consuming Shadows (effect#1) sp_coefficient 0.10 0.07
Legion Strike (effect#1) ap_coefficient 0.97 0.68
Grimoire of Service (effect#1) base_value 15.00 25.00
Demonology Warlock (effect#1) base_value 5.00 10.00
Demonology Warlock (effect#2) base_value 5.00 10.00
Demonology Warlock (effect#3) base_value 5.00 10.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

DL_GF_Felguard : 17283 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17283.5 17283.5 15.7 / 0.091% 2256.2 / 13.1% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.5 954.5 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_GF_Felguard 17283
Demonbolt 1252 7.3% 44.1 6.21sec 8515 7483 Direct 45.0 7109 14225 8356 17.5%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.12 44.96 0.00 0.00 1.1379 0.0000 375712.11 375712.11 0.00 7482.81 7482.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.08 82.46% 7108.74 6520 8308 7109.88 6887 7334 263566 263566 0.00
crit 7.88 17.54% 14224.54 13040 16616 14224.01 0 16616 112146 112146 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1052 6.1% 60.4 4.90sec 5222 4740 Direct 60.3 4447 8903 5234 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.43 60.30 0.00 0.00 1.1018 0.0000 315603.24 315603.24 0.00 4739.85 4739.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.66 82.35% 4446.94 1634 5979 4440.67 4010 4799 220834 220834 0.00
crit 10.64 17.65% 8902.91 3267 11958 8896.78 4988 11139 94769 94769 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 36.80sec 8294 0 Direct 7.3 4925 9849 5812 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 0.0000 0.0000 42393.71 42393.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.98 81.98% 4924.62 4925 4925 4922.65 0 4925 29447 29447 0.00
crit 1.31 18.02% 9849.24 9849 9849 7311.57 0 9849 12946 12946 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 36.80sec 2482 0 Direct 7.3 2111 4221 2482 17.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 0.0000 0.0000 18105.40 18105.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.39% 2110.55 2111 2111 2108.86 0 2111 12684 12684 0.00
crit 1.28 17.61% 4221.10 4221 4221 3101.44 0 4221 5422 5422 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1343 7.8% 95.8 3.05sec 4203 2814 Direct 95.1 3595 7191 4233 17.8%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.81 95.13 0.00 0.00 1.4935 0.0000 402713.79 402713.79 0.00 2814.27 2814.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.24 82.24% 3594.73 3373 4297 3595.33 3553 3657 281242 281242 0.00
crit 16.89 17.76% 7191.10 6745 8595 7192.13 6910 7660 121472 121472 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 289 1.7% 7.3 37.04sec 11876 0 Direct 7.2 10240 20481 12044 17.6%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.21 0.00 0.00 0.0000 0.0000 86825.58 86825.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.94 82.37% 10240.44 10240 10240 10228.15 0 10240 60801 60801 0.00
crit 1.27 17.63% 20480.88 20481 20481 14720.51 0 20481 26024 26024 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3163 / 3163
Felstorm 379 2.2% 10.4 30.14sec 10904 2895 Periodic 62.1 1553 3105 1828 17.7% 13.1%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.41 0.00 62.10 62.10 3.7665 0.6316 113539.52 162318.38 30.05 2895.01 2895.01
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.1 82.25% 1552.87 1454 1910 1552.84 1523 1601 79318 113395 30.05
crit 11.0 17.75% 3105.44 2908 3820 3105.19 2953 3399 34221 48924 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1061 6.1% 58.4 5.09sec 5439 5415 Direct 58.4 4626 9252 5439 17.6%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.43 58.43 0.00 0.00 1.0045 0.0000 317766.98 454286.06 30.05 5414.51 5414.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.16 82.42% 4625.68 4179 5592 4626.39 4519 4756 222750 318448 30.05
crit 10.27 17.58% 9251.56 8359 11183 9254.69 8490 10899 95017 135838 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1724 10.0% 173.7 1.71sec 2975 2007 Direct 173.7 2529 5055 2974 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.73 173.73 0.00 0.00 1.4822 0.0000 516769.72 738784.38 30.05 2006.83 2006.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.11 82.37% 2529.14 2284 3056 2529.54 2491 2576 361933 517427 30.05
crit 30.63 17.63% 5055.47 4569 6113 5056.15 4752 5433 154836 221357 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - grimoire_felguard 4762 / 1031
Felstorm 651 0.8% 3.9 80.78sec 10627 3630 Periodic 19.5 1830 3661 2150 17.5% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 19.47 19.47 2.9280 0.5924 41868.91 59856.63 30.05 3629.73 3629.73
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.1 82.51% 1829.89 1715 2197 1830.47 1765 1977 29397 42027 30.05
crit 3.4 17.49% 3661.12 3430 4393 3578.97 0 4393 12472 17830 29.37
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1848 2.3% 18.4 13.89sec 6450 6450 Direct 18.4 5476 10970 6450 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.44 18.44 0.00 0.00 1.0000 0.0000 118958.80 170065.89 30.05 6450.08 6450.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.18 82.28% 5476.48 5020 6430 5478.89 5207 6055 83113 118820 30.05
crit 3.27 17.72% 10970.22 10040 12861 10704.92 0 12453 35845 51245 29.33
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2263 2.8% 41.0 6.34sec 3555 3005 Direct 41.0 3020 6043 3555 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.95 40.95 0.00 0.00 1.1830 0.0000 145565.23 208102.97 30.05 3004.88 3004.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.71 82.33% 3020.49 2744 3515 3021.36 2931 3244 101835 145586 30.05
crit 7.24 17.67% 6043.35 5488 7030 6044.36 5488 6756 43730 62517 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - vicious_hellhound 1063 / 144
Demon Fangs 655 0.5% 9.3 12.07sec 2820 2820 Direct 9.3 2393 4792 2820 17.8%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.34 9.34 0.00 0.00 1.0000 0.0000 26347.10 26347.10 0.00 2820.28 2820.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.68 82.18% 2392.79 2116 2582 2392.69 0 2582 18370 18370 0.00
crit 1.66 17.82% 4791.70 4233 5163 3655.03 0 5163 7977 7977 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 407 0.3% 82.8 1.31sec 196 326 Direct 82.8 167 333 196 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.81 82.81 0.00 0.00 0.6015 0.0000 16230.51 23203.46 30.05 325.87 325.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.18 82.34% 166.55 147 179 166.71 147 178 11356 16234 30.05
crit 14.63 17.66% 333.28 294 358 333.32 0 358 4875 6969 30.02
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - shivarra 1939 / 260
melee 838 0.6% 42.4 2.57sec 782 664 Direct 42.4 665 1329 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.43 42.43 0.00 0.00 1.1773 0.0000 33180.71 47435.81 30.05 664.21 664.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.95 82.37% 664.84 587 717 665.60 587 714 23239 33222 30.05
crit 7.48 17.63% 1329.21 1175 1433 1310.36 0 1433 9942 14214 29.61
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 418 0.3% 42.4 2.57sec 391 314 Direct 42.4 332 665 391 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.43 42.43 0.00 0.00 1.2445 0.0000 16583.98 23708.79 30.05 314.04 314.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.97 82.42% 332.41 294 358 332.76 294 357 11626 16620 30.05
crit 7.46 17.58% 664.68 587 717 656.30 0 717 4958 7089 29.65
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (92) 0.0% (0.5%) 0.0 0.00sec 0 3973

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3972.65 3972.65
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 170 0.1% 6.9 17.19sec 992 0 Direct 6.9 844 1687 992 17.6%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.86 6.86 0.00 0.00 0.0000 0.0000 6801.99 9724.26 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.65 82.43% 843.92 749 914 841.37 0 914 4770 6819 29.91
crit 1.20 17.57% 1686.95 1498 1827 1138.50 0 1827 2032 2905 20.24
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 171 0.1% 6.9 17.19sec 993 0 Direct 6.9 844 1690 993 17.7%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.86 6.86 0.00 0.00 0.0000 0.0000 6811.70 9738.14 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.64 82.30% 843.57 749 914 840.13 0 914 4760 6806 29.87
crit 1.21 17.70% 1690.20 1498 1827 1140.23 0 1827 2051 2933 20.26
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 171 0.1% 6.9 17.19sec 994 0 Direct 6.9 843 1691 994 17.7%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.86 6.86 0.00 0.00 0.0000 0.0000 6812.92 9739.89 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.64 82.29% 843.50 749 914 842.05 0 914 4759 6804 29.95
crit 1.21 17.71% 1690.87 1498 1827 1153.11 0 1827 2054 2936 20.49
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 171 0.1% 6.9 17.19sec 993 0 Direct 6.9 844 1690 993 17.7%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.86 6.86 0.00 0.00 0.0000 0.0000 6809.85 9735.50 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.65 82.33% 843.56 749 914 841.95 0 914 4762 6808 29.94
crit 1.21 17.67% 1690.33 1498 1827 1130.25 0 1827 2048 2927 20.08
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vilefiend 3208 / 1517
Bile Spit 1168 3.2% 6.8 47.25sec 24273 0 Direct 6.8 8928 17884 10500 17.5%  
Periodic 33.2 2822 0 2822 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.79 6.77 33.18 33.18 0.0000 2.0000 164761.51 164761.51 0.00 2482.92 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.59 82.45% 8928.44 8474 10104 8925.08 0 9664 49868 49868 0.00
crit 1.19 17.55% 17883.86 16947 20207 13052.42 0 20207 21261 21261 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.2 100.00% 2822.09 2502 3310 2822.78 2633 2885 93633 93633 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.0% 28.5 10.29sec 3650 3650 Direct 28.5 3106 6208 3650 17.5%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.49 28.49 0.00 0.00 1.0000 0.0000 104013.41 148699.66 30.05 3650.36 3650.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.49 82.45% 3105.92 2737 3621 3107.21 2945 3245 72970 104320 30.05
crit 5.00 17.55% 6208.26 5474 7243 6172.79 0 7243 31043 44380 29.87
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1307 3.6% 102.8 2.83sec 1802 1355 Direct 102.8 1531 3062 1802 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.78 102.78 0.00 0.00 1.3301 0.0000 185175.16 264730.13 30.05 1354.55 1354.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.58 82.29% 1530.51 1337 1775 1531.08 1479 1571 129448 185061 30.05
crit 18.20 17.71% 3062.15 2673 3550 3063.01 2837 3332 55728 79669 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3638 / 2404
Dreadbite 1333 5.1% 29.1 20.93sec 9074 0 Direct 29.1 7720 15435 9074 17.6%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.09 29.09 0.00 0.00 0.0000 0.0000 263978.20 263978.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.98 82.44% 7719.56 7139 9517 7719.92 7450 7984 185126 185126 0.00
crit 5.11 17.56% 15434.96 14278 19033 15366.27 0 19033 78852 78852 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 8.8% 312.3 1.89sec 1463 1106 Direct 312.3 1244 2487 1463 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.27 312.27 0.00 0.00 1.3232 0.0000 456993.47 653327.04 30.05 1105.96 1105.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.12 82.34% 1243.76 1101 1473 1243.93 1226 1264 319793 457182 30.05
crit 55.16 17.66% 2487.50 2203 2947 2487.79 2378 2612 137201 196145 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 2576 / 2475
Fel Firebolt 2576 14.4% 994.9 0.29sec 746 502 Direct 990.8 637 1274 749 17.6%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 994.94 990.82 0.00 0.00 1.4872 0.0000 742522.31 742522.31 0.00 501.80 501.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 815.97 82.35% 636.98 569 761 637.00 626 649 519753 519753 0.00
crit 174.85 17.65% 1274.04 1138 1523 1274.06 1240 1310 222770 222770 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4663 / 824
Demonfire 4663 4.8% 37.8 6.91sec 6532 4892 Direct 37.7 5561 11119 6546 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.78 37.70 0.00 0.00 1.3353 0.0000 246789.80 246789.80 0.00 4891.67 4891.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.01 82.26% 5560.81 5312 5917 5564.12 5462 5663 172450 172450 0.00
crit 6.69 17.74% 11119.36 10624 11834 11109.40 0 11834 74340 74340 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1736 / 234
melee 844 0.6% 42.9 2.65sec 783 666 Direct 42.9 665 1330 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.90 42.90 0.00 0.00 1.1755 0.0000 33588.60 48018.94 30.05 666.12 666.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.28 82.23% 664.85 587 717 665.45 587 714 23453 33529 30.05
crit 7.62 17.77% 1329.89 1175 1433 1313.80 0 1433 10136 14490 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 422 0.3% 42.9 2.65sec 391 315 Direct 42.9 332 665 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.90 42.90 0.00 0.00 1.2429 0.0000 16782.56 23992.68 30.05 314.79 314.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.31 82.31% 332.46 294 358 332.78 294 357 11738 16781 30.05
crit 7.59 17.69% 664.62 587 717 657.57 0 717 5044 7212 29.72
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 471 0.4% 8.9 13.16sec 2112 2112 Direct 8.9 1795 3592 2112 17.6%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.94 8.94 0.00 0.00 1.0000 0.0000 18886.87 27001.05 30.05 2111.92 2111.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.37 82.38% 1795.32 1586 1935 1793.59 0 1935 13228 18911 29.96
crit 1.58 17.62% 3591.75 3172 3870 2682.50 0 3870 5659 8091 22.42
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - eye_of_guldan 991 / 82
Eye of Gul'dan 991 0.5% 27.6 4.62sec 873 1148 Periodic 60.1 400 0 400 0.0% 58.8%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.56 0.00 60.09 60.09 0.7601 2.9369 24058.74 24058.74 0.00 121.86 1148.39
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.1 100.00% 400.35 181 461 399.44 361 405 24059 24059 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - bilescourge 3891 / 521
Toxic Bile 3891 3.0% 54.6 2.09sec 2825 3040 Direct 54.6 2401 4800 2825 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.55 54.55 0.00 0.00 0.9293 0.0000 154127.59 154127.59 0.00 3040.23 3040.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.91 82.32% 2401.13 2116 2582 2403.08 2116 2570 107825 107825 0.00
crit 9.65 17.68% 4799.80 4233 5163 4778.90 0 5163 46302 46302 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - void_terror 1823 / 246
Double Breath 0 (133) 0.0% (0.8%) 0.0 0.00sec 0 7399

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7399.33 7399.33
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 492 0.4% 7.0 17.35sec 2809 0 Direct 7.0 2389 4778 2809 17.6%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 19742.05 19742.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.79 82.42% 2388.62 2116 2582 2385.48 0 2582 13839 13839 0.00
crit 1.24 17.58% 4778.22 4233 5163 3230.24 0 5163 5903 5903 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 491 0.4% 7.0 17.35sec 2803 0 Direct 7.0 2389 4778 2803 17.3%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 19703.76 19703.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.81 82.65% 2388.65 2116 2582 2388.71 0 2582 13877 13877 0.00
crit 1.22 17.35% 4777.87 4233 5163 3191.95 0 5163 5826 5826 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 839 0.6% 42.7 2.67sec 783 666 Direct 42.7 665 1329 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.70 42.70 0.00 0.00 1.1755 0.0000 33435.51 47800.07 30.05 666.07 666.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.12 82.23% 664.89 587 717 665.69 587 714 23348 33379 30.05
crit 7.59 17.77% 1329.12 1175 1433 1313.07 0 1433 10088 14421 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - urzul 1335 / 179
Many Faced Bite 499 0.4% 9.4 12.55sec 2109 2109 Direct 9.4 1791 3585 2109 17.7%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.42 9.42 0.00 0.00 1.0000 0.0000 19866.32 28401.29 30.05 2109.40 2109.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.75 82.28% 1791.34 1586 1935 1792.50 0 1935 13883 19847 30.00
crit 1.67 17.72% 3584.86 3172 3870 2760.45 0 3870 5984 8554 23.12
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 836 0.6% 42.3 2.70sec 781 663 Direct 42.3 665 1329 781 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.33 42.33 0.00 0.00 1.1778 0.0000 33072.93 47281.73 30.05 663.30 663.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.90 82.44% 664.55 587 717 665.47 587 714 23191 33155 30.05
crit 7.44 17.56% 1329.00 1175 1433 1313.97 0 1433 9882 14127 29.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - illidari_satyr 1269 / 172
melee 419 0.3% 42.8 2.70sec 391 332 Direct 42.8 332 665 391 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.77 42.77 0.00 0.00 1.1776 0.0000 16741.63 23934.17 30.05 332.39 332.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.16 82.21% 332.30 294 358 332.63 294 357 11684 16704 30.05
crit 7.61 17.79% 664.71 587 717 657.42 0 717 5057 7230 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 209 0.2% 42.8 2.70sec 195 157 Direct 42.8 166 332 195 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.77 42.77 0.00 0.00 1.2454 0.0000 8358.53 11949.53 30.05 156.93 156.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.24 82.39% 166.14 147 179 166.31 147 178 5854 8370 30.05
crit 7.53 17.61% 332.43 294 358 328.64 0 358 2504 3580 29.67
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 642 0.5% 9.2 12.96sec 2824 2824 Direct 9.2 2394 4789 2825 18.0%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.16 9.16 0.00 0.00 1.0000 0.0000 25875.17 25875.17 0.00 2824.49 2824.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.52 82.04% 2394.35 2116 2582 2394.68 0 2582 17994 17994 0.00
crit 1.65 17.96% 4788.57 4233 5163 3670.72 0 5163 7881 7881 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - darkhound 1304 / 173
Fel Bite 467 0.4% 8.8 13.08sec 2110 2110 Direct 8.8 1796 3589 2110 17.5%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.75 8.75 0.00 0.00 1.0000 0.0000 18467.41 26401.38 30.05 2110.08 2110.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.22 82.49% 1796.03 1586 1935 1797.83 0 1935 12968 18539 30.00
crit 1.53 17.51% 3588.70 3172 3870 2649.88 0 3870 5500 7862 22.16
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 836 0.6% 41.9 2.64sec 782 665 Direct 41.9 665 1330 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.90 41.90 0.00 0.00 1.1755 0.0000 32764.55 46840.86 30.05 665.16 665.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.53 82.40% 664.89 587 717 665.84 587 714 22956 32819 30.05
crit 7.38 17.60% 1329.67 1175 1433 1312.13 0 1433 9808 14022 29.61
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - prince_malchezaar 4682 / 392
melee 3111 1.5% 21.0 1.56sec 3682 3144 Direct 21.0 3153 6294 3682 16.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.03 21.03 0.00 0.00 1.1712 0.0000 77434.18 110701.45 30.05 3143.51 3143.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.49 83.18% 3153.00 2784 3396 3158.78 2784 3381 55161 78859 30.05
crit 3.54 16.82% 6293.80 5567 6791 6066.56 0 6791 22274 31843 28.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1571 0.8% 21.0 1.56sec 1858 1500 Direct 21.0 1576 3151 1857 17.9%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.03 21.03 0.00 0.00 1.2381 0.0000 39069.81 55854.99 30.05 1500.32 1500.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.27 82.13% 1576.12 1392 1698 1579.34 1392 1691 27228 38925 30.05
crit 3.76 17.87% 3150.75 2784 3396 3040.89 0 3396 11842 16930 28.97
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DL_GF_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.27sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.93sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 1.2015 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.75sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1278 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2378 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.46sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 1.5114 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 15.2 14.67sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.15 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.25sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.79 0.00 0.00 0.00 1.5396 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.14sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 8.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.3 23.2sec 10.2sec 51.89% 83.69% 15.3(15.3) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.89%

Trigger Attempt Success

  • trigger_pct:19.96%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.4 30.0 12.4sec 5.3sec 38.53% 100.00% 4.4(4.4) 0.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.81%
  • demonic_core_2:15.69%
  • demonic_core_3:4.93%
  • demonic_core_4:2.10%

Trigger Attempt Success

  • trigger_pct:25.71%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.6sec 10.1sec 66.09% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.66%
  • dreadstalkers_4:6.43%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 182.0sec 1.8sec 1.24% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.24%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.7sec 120.7sec 19.75% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.5sec 171.5sec 14.87% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.89%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.27% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 66.7sec 36.5sec 44.27% 0.00% 3.0(40.8) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.56%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.65%
  • overwhelming_power_11:1.69%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.83%
  • overwhelming_power_15:1.88%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.99%
  • overwhelming_power_18:2.05%
  • overwhelming_power_19:2.11%
  • overwhelming_power_20:2.16%
  • overwhelming_power_21:2.22%
  • overwhelming_power_22:2.28%
  • overwhelming_power_23:2.35%
  • overwhelming_power_24:2.41%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.2 182.8sec 14.7sec 19.61% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.01%
  • portal_summons_2:0.76%
  • portal_summons_3:1.26%
  • portal_summons_4:1.97%
  • portal_summons_5:1.37%
  • portal_summons_6:1.74%
  • portal_summons_7:4.29%
  • portal_summons_8:6.17%
  • portal_summons_9:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 182.6sec 99.7sec 1.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.4sec 10.4sec 67.60% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.77%
  • quick_navigation_2:17.17%
  • quick_navigation_3:16.55%
  • quick_navigation_4:16.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.3sec 52.3sec 17.46% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 79.9sec 17.09% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.40% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.40%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.7 55.7sec 0.0sec 96.10% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.31%
  • wild_imps_2:2.75%
  • wild_imps_3:28.79%
  • wild_imps_4:7.70%
  • wild_imps_5:9.46%
  • wild_imps_6:26.06%
  • wild_imps_7:5.88%
  • wild_imps_8:3.95%
  • wild_imps_9:4.80%
  • wild_imps_10:1.53%
  • wild_imps_11:1.14%
  • wild_imps_12:1.10%
  • wild_imps_13:0.42%
  • wild_imps_14:0.17%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.7sec 120.7sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.2 13.9sec
one_shard_hog 8.9 21.8sec
two_shard_hog 3.8 16.3sec
three_shard_hog 47.8 5.8sec
portal_summon 15.2 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_GF_Felguard
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 45.1 90242.3 2000.0 2045.2 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.4 159.8 2.6 2.6 1975.5
shadow_bolt Mana 95.8 191631.8 2000.0 2000.1 2.1
summon_demonic_tyrant Mana 3.6 7197.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
felstorm Energy 10.4 624.7 60.0 60.0 181.7
legion_strike Energy 58.4 3505.6 60.0 60.0 90.6
pet - grimoire_felguard
felstorm Energy 3.9 236.4 60.0 60.0 177.1
legion_strike Energy 18.4 1106.7 60.0 60.0 107.5
pet - wild_imp
fel_firebolt Energy 994.9 15594.1 15.7 15.7 47.6
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.12 90.23 (48.50%) 2.00 0.01 0.01%
shadow_bolt Soul Shard 95.82 95.82 (51.50%) 1.00 0.00 0.00%
mana_regen Mana 555.32 286366.06 (100.00%) 515.68 13100.21 4.37%
pet - felguard
energy_regen Energy 375.59 3990.25 (100.00%) 10.62 18.58 0.46%
pet - grimoire_felguard
energy_regen Energy 91.67 914.41 (100.00%) 9.97 48.41 5.03%
pet - demonic_tyrant
energy_regen Energy 37.79 0.00 (0.00%) 0.00 762.80 100.00%
pet - bilescourge
energy_regen Energy 14.14 0.00 (0.00%) 0.00 196.02 100.00%
pet - bilescourge
energy_regen Energy 10.83 0.00 (0.00%) 0.00 150.58 100.00%
pet - bilescourge
energy_regen Energy 10.87 0.00 (0.00%) 0.00 151.07 100.00%
pet - bilescourge
energy_regen Energy 12.14 0.00 (0.00%) 0.00 169.11 100.00%
pet - bilescourge
energy_regen Energy 3.07 0.00 (0.00%) 0.00 42.67 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.52 963.54
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97313.16 92307.00 100000.00
Soul Shard 2.57 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.6%

Statistics & Data Analysis

Fight Length
Sample Data DL_GF_Felguard Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_GF_Felguard Damage Per Second
Count 4999
Mean 17283.47
Minimum 15722.13
Maximum 19416.94
Spread ( max - min ) 3694.81
Range [ ( max - min ) / 2 * 100% ] 10.69%
Standard Deviation 566.1722
5th Percentile 16424.45
95th Percentile 18285.56
( 95th Percentile - 5th Percentile ) 1861.10
Mean Distribution
Standard Deviation 8.0077
95.00% Confidence Intervall ( 17267.78 - 17299.17 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4123
0.1 Scale Factor Error with Delta=300 2737
0.05 Scale Factor Error with Delta=300 10946
0.01 Scale Factor Error with Delta=300 273641
Priority Target DPS
Sample Data DL_GF_Felguard Priority Target Damage Per Second
Count 4999
Mean 17283.47
Minimum 15722.13
Maximum 19416.94
Spread ( max - min ) 3694.81
Range [ ( max - min ) / 2 * 100% ] 10.69%
Standard Deviation 566.1722
5th Percentile 16424.45
95th Percentile 18285.56
( 95th Percentile - 5th Percentile ) 1861.10
Mean Distribution
Standard Deviation 8.0077
95.00% Confidence Intervall ( 17267.78 - 17299.17 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4123
0.1 Scale Factor Error with Delta=300 2737
0.05 Scale Factor Error with Delta=300 10946
0.01 Scale Factor Error with Delta=300 273641
DPS(e)
Sample Data DL_GF_Felguard Damage Per Second (Effective)
Count 4999
Mean 17283.47
Minimum 15722.13
Maximum 19416.94
Spread ( max - min ) 3694.81
Range [ ( max - min ) / 2 * 100% ] 10.69%
Damage
Sample Data DL_GF_Felguard Damage
Count 4999
Mean 1241353.83
Minimum 873631.95
Maximum 1656571.77
Spread ( max - min ) 782939.83
Range [ ( max - min ) / 2 * 100% ] 31.54%
DTPS
Sample Data DL_GF_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_GF_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_GF_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_GF_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_GF_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_GF_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_GF_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_GF_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.81 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.59 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.63 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.48 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.34 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.34 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.70 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.94 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.78 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.54 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.92 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKKKKKHFIHIKHKKIHIHKIHIKHKKIFKEHKKKHIIHKKKFHKKKHKKKHIKKKHFIIHIKKEHG8KKHKKKFKHKKIHIHIIDHIKKFHIKHKKKKEHIIKFHIHKKKHKKKKKaKYKKKKaKKKXSSVPKQST9AVSVSVSKKKHKKKKFHIKHKIHIIHIHIKKFIHEIHIDIHIIHKKFKHIKHKKKHKKKIHKIHFIKKEHKIGHKKHKKFK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active O grimoire_felguard Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.259 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.568 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:04.876 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:05.857 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:07.165 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:07.165 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.165 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.265 nether_portal_active S hand_of_guldan Fluffy_Pillow 97104.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.084 build_a_shard K shadow_bolt Fluffy_Pillow 97923.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.171 nether_portal_active S hand_of_guldan Fluffy_Pillow 97010.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.986 build_a_shard K shadow_bolt Fluffy_Pillow 97825.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.074 nether_portal_active S hand_of_guldan Fluffy_Pillow 96913.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.866 build_a_shard K shadow_bolt Fluffy_Pillow 97705.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.920 nether_portal_active S hand_of_guldan Fluffy_Pillow 96759.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation(3), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.707 build_a_shard K shadow_bolt Fluffy_Pillow 97546.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.754 nether_portal_active S hand_of_guldan Fluffy_Pillow 96593.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.515 build_a_shard K shadow_bolt Fluffy_Pillow 97354.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.529 nether_portal_active S hand_of_guldan Fluffy_Pillow 96368.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.401 build_a_shard K shadow_bolt Fluffy_Pillow 97240.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.562 build_a_shard K shadow_bolt Fluffy_Pillow 96401.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.690 build_a_shard K shadow_bolt Fluffy_Pillow 95529.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.817 build_a_shard K shadow_bolt Fluffy_Pillow 94656.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.944 build_a_shard K shadow_bolt Fluffy_Pillow 93783.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:24.070 default H hand_of_guldan Fluffy_Pillow 92909.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), ignition_mages_fuse(5)
0:24.891 default F call_dreadstalkers Fluffy_Pillow 93730.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.712 default I demonbolt Fluffy_Pillow 94551.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.534 default H hand_of_guldan Fluffy_Pillow 93373.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.356 default I demonbolt Fluffy_Pillow 94195.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(6)
0:28.314 build_a_shard K shadow_bolt Fluffy_Pillow 93153.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(6)
0:29.593 default H hand_of_guldan Fluffy_Pillow 92432.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(6)
0:30.425 build_a_shard K shadow_bolt Fluffy_Pillow 93264.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(7)
0:31.538 build_a_shard K shadow_bolt Fluffy_Pillow 92377.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(7)
0:32.613 default I demonbolt Fluffy_Pillow 91452.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(7)
0:33.426 default H hand_of_guldan Fluffy_Pillow 90265.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(7)
0:34.242 default I demonbolt Fluffy_Pillow 91081.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(7)
0:35.060 default H hand_of_guldan Fluffy_Pillow 89899.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(8)
0:35.884 build_a_shard K shadow_bolt Fluffy_Pillow 90723.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(8)
0:36.980 default I demonbolt Fluffy_Pillow 89819.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(5), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(8)
0:37.810 default H hand_of_guldan Fluffy_Pillow 88649.0/100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(8)
0:38.644 default I demonbolt Fluffy_Pillow 89483.0/100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(8)
0:39.482 build_a_shard K shadow_bolt Fluffy_Pillow 88321.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(8)
0:40.603 default H hand_of_guldan Fluffy_Pillow 87442.0/100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(9), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(9)
0:41.448 build_a_shard K shadow_bolt Fluffy_Pillow 88287.0/100000: 88% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(9)
0:42.921 build_a_shard K shadow_bolt Fluffy_Pillow 87760.0/100000: 88% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(8), overwhelming_power(12), archive_of_the_titans(9)
0:44.503 default I demonbolt Fluffy_Pillow 87342.0/100000: 87% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), overwhelming_power(10), archive_of_the_titans(9)
0:45.705 default F call_dreadstalkers Fluffy_Pillow 86544.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), overwhelming_power(9), archive_of_the_titans(10)
0:46.913 build_a_shard K shadow_bolt Fluffy_Pillow 87752.0/100000: 88% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), overwhelming_power(8), archive_of_the_titans(10)
0:48.531 default E summon_vilefiend Fluffy_Pillow 87370.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(6), archive_of_the_titans(10)
0:50.191 default H hand_of_guldan Fluffy_Pillow 89030.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(4), archive_of_the_titans(11)
0:51.427 build_a_shard K shadow_bolt Fluffy_Pillow 90266.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_calling, dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(3), archive_of_the_titans(11)
0:53.087 build_a_shard K shadow_bolt Fluffy_Pillow 89926.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power, archive_of_the_titans(11)
0:54.767 build_a_shard K shadow_bolt Fluffy_Pillow 89606.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:56.455 default H hand_of_guldan Fluffy_Pillow 89294.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(12)
0:57.725 default I demonbolt Fluffy_Pillow 90564.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, archive_of_the_titans(12)
0:58.995 default I demonbolt Fluffy_Pillow 89834.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(12)
1:00.264 default H hand_of_guldan Fluffy_Pillow 89103.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation, archive_of_the_titans(13)
1:01.531 build_a_shard K shadow_bolt Fluffy_Pillow 90370.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation, overwhelming_power(25), archive_of_the_titans(13)
1:02.993 build_a_shard K shadow_bolt Fluffy_Pillow 89832.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), overwhelming_power(24), archive_of_the_titans(13)
1:04.456 build_a_shard K shadow_bolt Fluffy_Pillow 89295.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power(22), archive_of_the_titans(13)
1:05.934 default F call_dreadstalkers Fluffy_Pillow 88773.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(14)
1:07.049 default H hand_of_guldan Fluffy_Pillow 89888.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(14)
1:08.176 build_a_shard K shadow_bolt Fluffy_Pillow 91015.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(14)
1:09.679 build_a_shard K shadow_bolt Fluffy_Pillow 90518.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), overwhelming_power(25), archive_of_the_titans(14)
1:11.126 build_a_shard K shadow_bolt Fluffy_Pillow 89965.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(15)
1:12.581 default H hand_of_guldan Fluffy_Pillow 89420.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(15)
1:13.681 build_a_shard K shadow_bolt Fluffy_Pillow 90520.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(15)
1:15.153 build_a_shard K shadow_bolt Fluffy_Pillow 89992.0/100000: 90% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(16)
1:16.641 build_a_shard K shadow_bolt Fluffy_Pillow 89480.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(16)
1:18.136 default H hand_of_guldan Fluffy_Pillow 88975.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(16)
1:19.272 default I demonbolt Fluffy_Pillow 90111.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(16)
1:20.415 build_a_shard K shadow_bolt Fluffy_Pillow 89254.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(17)
1:21.945 build_a_shard K shadow_bolt Fluffy_Pillow 88784.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), quick_navigation(4), overwhelming_power(13), archive_of_the_titans(17)
1:23.483 build_a_shard K shadow_bolt Fluffy_Pillow 88322.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), quick_navigation(4), overwhelming_power(11), archive_of_the_titans(17)
1:25.039 default H hand_of_guldan Fluffy_Pillow 87878.0/100000: 88% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(3), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(18)
1:26.167 default F call_dreadstalkers Fluffy_Pillow 89006.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(3), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(18)
1:27.680 default I demonbolt Fluffy_Pillow 90519.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(18)
1:28.821 default I demonbolt Fluffy_Pillow 89660.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(18)
1:29.968 default H hand_of_guldan Fluffy_Pillow 88807.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(18)
1:31.122 default I demonbolt Fluffy_Pillow 89961.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(19)
1:32.288 build_a_shard K shadow_bolt Fluffy_Pillow 89127.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(2), archive_of_the_titans(19)
1:33.852 build_a_shard K shadow_bolt Fluffy_Pillow 88691.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(19)
1:35.234 default E summon_vilefiend Fluffy_Pillow 88073.0/100000: 88% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), overwhelming_power(23), archive_of_the_titans(20)
1:36.721 default H hand_of_guldan Fluffy_Pillow 89560.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(22), archive_of_the_titans(20)
1:37.844 default G summon_demonic_tyrant Fluffy_Pillow 90683.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(21), archive_of_the_titans(20)
1:39.346 default 8 potion Fluffy_Pillow 90185.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(19), archive_of_the_titans(20)
1:39.346 build_a_shard K shadow_bolt Fluffy_Pillow 90185.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
1:40.868 build_a_shard K shadow_bolt Fluffy_Pillow 89707.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:42.330 default H hand_of_guldan Fluffy_Pillow 89169.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect
1:43.442 build_a_shard K shadow_bolt Fluffy_Pillow 90281.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect
1:44.929 build_a_shard K shadow_bolt Fluffy_Pillow 89768.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
1:46.414 build_a_shard K shadow_bolt Fluffy_Pillow 89253.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
1:47.910 default F call_dreadstalkers Fluffy_Pillow 88749.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
1:49.039 build_a_shard K shadow_bolt Fluffy_Pillow 89878.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
1:50.560 default H hand_of_guldan Fluffy_Pillow 89399.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
1:51.699 build_a_shard K shadow_bolt Fluffy_Pillow 90538.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
1:53.228 build_a_shard K shadow_bolt Fluffy_Pillow 90067.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
1:54.774 default I demonbolt Fluffy_Pillow 89613.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect
1:55.942 default H hand_of_guldan Fluffy_Pillow 88781.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect
1:57.118 default I demonbolt Fluffy_Pillow 89957.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect
1:58.303 default H hand_of_guldan Fluffy_Pillow 89142.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect
1:59.498 default I demonbolt Fluffy_Pillow 90337.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(6), archive_of_the_titans(20), battle_potion_of_intellect
2:00.700 default I demonbolt Fluffy_Pillow 89539.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), vilefiend, quick_navigation(4), overwhelming_power(5), archive_of_the_titans(20), battle_potion_of_intellect
2:01.908 default D grimoire_felguard Fluffy_Pillow 88747.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), vilefiend, quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20), battle_potion_of_intellect
2:03.124 default H hand_of_guldan Fluffy_Pillow 89963.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(2), archive_of_the_titans(20), battle_potion_of_intellect
2:04.356 default I demonbolt Fluffy_Pillow 91195.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power, archive_of_the_titans(20)
2:05.537 build_a_shard K shadow_bolt Fluffy_Pillow 90376.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:07.119 build_a_shard K shadow_bolt Fluffy_Pillow 89958.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:08.704 default F call_dreadstalkers Fluffy_Pillow 89543.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:09.891 default H hand_of_guldan Fluffy_Pillow 90730.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:11.078 default I demonbolt Fluffy_Pillow 91917.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:12.264 build_a_shard K shadow_bolt Fluffy_Pillow 91103.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:13.847 default H hand_of_guldan Fluffy_Pillow 90686.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:15.034 build_a_shard K shadow_bolt Fluffy_Pillow 91873.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), grimoire_felguard, archive_of_the_titans(20)
2:16.733 build_a_shard K shadow_bolt Fluffy_Pillow 91572.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), grimoire_felguard, archive_of_the_titans(20)
2:18.433 build_a_shard K shadow_bolt Fluffy_Pillow 91272.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
2:20.131 build_a_shard K shadow_bolt Fluffy_Pillow 90970.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
2:21.834 default E summon_vilefiend Fluffy_Pillow 90673.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), archive_of_the_titans(20)
2:23.534 default H hand_of_guldan Fluffy_Pillow 92373.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), vilefiend, archive_of_the_titans(20)
2:24.810 default I demonbolt Fluffy_Pillow 93649.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(2), vilefiend, quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
2:25.910 default I demonbolt Fluffy_Pillow 92749.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps, vilefiend, quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
2:27.017 build_a_shard K shadow_bolt Fluffy_Pillow 91856.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
2:28.506 default F call_dreadstalkers Fluffy_Pillow 91345.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
2:29.826 default H hand_of_guldan Fluffy_Pillow 92665.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
2:30.955 default I demonbolt Fluffy_Pillow 93794.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
2:32.092 default H hand_of_guldan Fluffy_Pillow 92931.0/100000: 93% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(17), archive_of_the_titans(20)
2:33.240 build_a_shard K shadow_bolt Fluffy_Pillow 94079.0/100000: 94% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(16), archive_of_the_titans(20)
2:34.777 build_a_shard K shadow_bolt Fluffy_Pillow 93616.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(15), archive_of_the_titans(20)
2:36.323 build_a_shard K shadow_bolt Fluffy_Pillow 93162.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(13), archive_of_the_titans(20)
2:37.887 default H hand_of_guldan Fluffy_Pillow 92726.0/100000: 93% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(12), archive_of_the_titans(20)
2:39.066 build_a_shard K shadow_bolt Fluffy_Pillow 93905.0/100000: 94% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(10), archive_of_the_titans(20)
2:40.656 build_a_shard K shadow_bolt Fluffy_Pillow 93495.0/100000: 93% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
2:42.246 build_a_shard K shadow_bolt Fluffy_Pillow 93085.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
2:43.856 build_a_shard K shadow_bolt Fluffy_Pillow 92695.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20)
2:45.475 build_a_shard K shadow_bolt Fluffy_Pillow 92314.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(3), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
2:47.115 nether_portal_building a hand_of_guldan Fluffy_Pillow 91954.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core(3), wild_imps(3), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(20)
2:48.361 build_a_shard K shadow_bolt Fluffy_Pillow 93200.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(4), wild_imps(2), quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
2:50.031 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 92870.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(4), wild_imps(2), quick_navigation(3), archive_of_the_titans(20)
2:51.701 build_a_shard K shadow_bolt Fluffy_Pillow 94540.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(4), wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:53.370 build_a_shard K shadow_bolt Fluffy_Pillow 94209.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(4), wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:55.038 build_a_shard K shadow_bolt Fluffy_Pillow 93877.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(4), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:56.705 build_a_shard K shadow_bolt Fluffy_Pillow 93544.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(4), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:58.366 nether_portal_building a hand_of_guldan Fluffy_Pillow 93205.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps, dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:59.553 build_a_shard K shadow_bolt Fluffy_Pillow 94392.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:01.135 build_a_shard K shadow_bolt Fluffy_Pillow 93974.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(4), demonic_calling, wild_imps(2), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:02.718 build_a_shard K shadow_bolt Fluffy_Pillow 93557.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(4), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:04.300 nether_portal_building X nether_portal Fluffy_Pillow 93139.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
3:05.488 nether_portal_active S hand_of_guldan Fluffy_Pillow 94327.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(3), portal_summons, quick_navigation_final, archive_of_the_titans(20)
3:06.677 nether_portal_active S hand_of_guldan Fluffy_Pillow 95516.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(3), portal_summons(2), quick_navigation_final, archive_of_the_titans(20)
3:07.863 nether_portal_active V demonbolt Fluffy_Pillow 96702.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation_final, archive_of_the_titans(20)
3:09.050 nether_portal_active P summon_vilefiend Fluffy_Pillow 95889.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), portal_summons(3), archive_of_the_titans(20)
3:10.750 build_a_shard K shadow_bolt Fluffy_Pillow 97589.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(4), archive_of_the_titans(20)
3:12.451 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 97290.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(4), archive_of_the_titans(20)
3:13.728 nether_portal_active S hand_of_guldan Fluffy_Pillow 98567.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(3), nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, portal_summons(5), archive_of_the_titans(20)
3:15.007 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 99846.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, portal_summons(6), quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
3:16.480 default 9 use_items Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
3:16.480 default A berserking Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse
3:16.480 nether_portal_active V demonbolt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse
3:17.419 nether_portal_active S hand_of_guldan Fluffy_Pillow 96945.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse
3:18.362 nether_portal_active V demonbolt Fluffy_Pillow 97888.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse
3:19.305 nether_portal_active S hand_of_guldan Fluffy_Pillow 96831.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, wild_imps, dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse
3:20.253 nether_portal_active V demonbolt Fluffy_Pillow 97779.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse
3:21.206 nether_portal_active S hand_of_guldan Fluffy_Pillow 96732.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.137 build_a_shard K shadow_bolt Fluffy_Pillow 97663.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(2)
3:23.375 build_a_shard K shadow_bolt Fluffy_Pillow 96901.0/100000: 97% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse(2)
3:24.622 build_a_shard K shadow_bolt Fluffy_Pillow 96148.0/100000: 96% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.840 default H hand_of_guldan Fluffy_Pillow 95366.0/100000: 95% mana | 3.0/5: 60% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.758 build_a_shard K shadow_bolt Fluffy_Pillow 96284.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse(3)
3:28.174 build_a_shard K shadow_bolt Fluffy_Pillow 95700.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse(3)
3:29.595 build_a_shard K shadow_bolt Fluffy_Pillow 95121.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.981 build_a_shard K shadow_bolt Fluffy_Pillow 94507.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(9), archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.378 default F call_dreadstalkers Fluffy_Pillow 93904.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(7), archive_of_the_titans(20), ignition_mages_fuse(4)
3:33.511 default H hand_of_guldan Fluffy_Pillow 95037.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(4), overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.547 default I demonbolt Fluffy_Pillow 96073.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(4), overwhelming_power(5), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.587 build_a_shard K shadow_bolt Fluffy_Pillow 95113.0/100000: 95% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.980 default H hand_of_guldan Fluffy_Pillow 94506.0/100000: 95% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(13), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
3:38.147 build_a_shard K shadow_bolt Fluffy_Pillow 95673.0/100000: 96% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power, archive_of_the_titans(20)
3:39.720 default I demonbolt Fluffy_Pillow 95246.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:40.909 default H hand_of_guldan Fluffy_Pillow 94435.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:42.096 default I demonbolt Fluffy_Pillow 95622.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:43.282 default I demonbolt Fluffy_Pillow 94808.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:44.471 default H hand_of_guldan Fluffy_Pillow 93997.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
3:45.658 default I demonbolt Fluffy_Pillow 95184.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
3:46.847 default H hand_of_guldan Fluffy_Pillow 94373.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(20)
3:48.036 default I demonbolt Fluffy_Pillow 95562.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), archive_of_the_titans(20)
3:49.313 build_a_shard K shadow_bolt Fluffy_Pillow 94839.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), archive_of_the_titans(20)
3:51.012 build_a_shard K shadow_bolt Fluffy_Pillow 94538.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(9), archive_of_the_titans(20)
3:52.712 default F call_dreadstalkers Fluffy_Pillow 94238.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(20)
3:53.990 default I demonbolt Fluffy_Pillow 95516.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
3:55.267 default H hand_of_guldan Fluffy_Pillow 94793.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
3:56.544 default E summon_vilefiend Fluffy_Pillow 96070.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:58.246 default I demonbolt Fluffy_Pillow 97772.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
3:59.522 default H hand_of_guldan Fluffy_Pillow 97048.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:00.799 default I demonbolt Fluffy_Pillow 98325.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:02.076 default D grimoire_felguard Fluffy_Pillow 97602.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:03.351 default I demonbolt Fluffy_Pillow 98877.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:04.628 default H hand_of_guldan Fluffy_Pillow 98154.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:05.907 default I demonbolt Fluffy_Pillow 99433.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:07.175 default I demonbolt Fluffy_Pillow 98701.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:08.444 default H hand_of_guldan Fluffy_Pillow 97970.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:09.714 build_a_shard K shadow_bolt Fluffy_Pillow 99240.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:11.405 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:13.094 default F call_dreadstalkers Fluffy_Pillow 97695.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:14.364 build_a_shard K shadow_bolt Fluffy_Pillow 98965.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:16.054 default H hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:17.315 default I demonbolt Fluffy_Pillow 99266.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:18.567 build_a_shard K shadow_bolt Fluffy_Pillow 98518.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:20.235 default H hand_of_guldan Fluffy_Pillow 98003.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:21.487 build_a_shard K shadow_bolt Fluffy_Pillow 99255.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:23.156 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:24.826 build_a_shard K shadow_bolt Fluffy_Pillow 97674.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:26.495 default H hand_of_guldan Fluffy_Pillow 97343.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
4:27.749 build_a_shard K shadow_bolt Fluffy_Pillow 98597.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(25), archive_of_the_titans(20)
4:29.197 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(3), overwhelming_power(23), archive_of_the_titans(20)
4:30.662 build_a_shard K shadow_bolt Fluffy_Pillow 97469.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(20)
4:32.132 default I demonbolt Fluffy_Pillow 96939.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(20), archive_of_the_titans(20)
4:33.248 default H hand_of_guldan Fluffy_Pillow 96055.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(19), archive_of_the_titans(20)
4:34.370 build_a_shard K shadow_bolt Fluffy_Pillow 97177.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
4:35.873 default I demonbolt Fluffy_Pillow 96680.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20)
4:37.009 default H hand_of_guldan Fluffy_Pillow 95816.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
4:38.158 default F call_dreadstalkers Fluffy_Pillow 96965.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
4:39.240 default I demonbolt Fluffy_Pillow 98047.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
4:40.327 build_a_shard K shadow_bolt Fluffy_Pillow 97134.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
4:41.782 build_a_shard K shadow_bolt Fluffy_Pillow 96589.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
4:43.187 default E summon_vilefiend Fluffy_Pillow 95994.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
4:44.659 default H hand_of_guldan Fluffy_Pillow 97466.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
4:45.731 build_a_shard K shadow_bolt Fluffy_Pillow 98538.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
4:47.165 default I demonbolt Fluffy_Pillow 97972.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)
4:48.252 default G summon_demonic_tyrant Fluffy_Pillow 97059.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
4:49.708 default H hand_of_guldan Fluffy_Pillow 96515.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
4:50.806 build_a_shard K shadow_bolt Fluffy_Pillow 97613.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
4:52.279 build_a_shard K shadow_bolt Fluffy_Pillow 97086.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(11), archive_of_the_titans(20)
4:53.870 default H hand_of_guldan Fluffy_Pillow 96677.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(10), archive_of_the_titans(20)
4:55.070 build_a_shard K shadow_bolt Fluffy_Pillow 97877.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
4:56.679 build_a_shard K shadow_bolt Fluffy_Pillow 97486.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
4:58.299 default F call_dreadstalkers Fluffy_Pillow 97106.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:59.399 build_a_shard K shadow_bolt Fluffy_Pillow 98206.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(24), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_GF_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DL_GF_Imp : 17276 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17275.5 17275.5 16.0 / 0.093% 2261.2 / 13.1% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.4 954.5 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_GF_Imp 17276
Demonbolt 1256 7.3% 44.2 6.20sec 8528 7493 Direct 45.0 7110 14220 8370 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.19 45.02 0.00 0.00 1.1381 0.0000 376820.68 376820.68 0.00 7493.10 7493.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.04 82.28% 7110.21 6520 8308 7111.53 6910 7336 263385 263385 0.00
crit 7.98 17.72% 14219.85 13040 16616 14219.32 0 16616 113436 113436 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1052 6.1% 60.4 4.90sec 5226 4742 Direct 60.3 4451 8886 5236 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.43 60.31 0.00 0.00 1.1021 0.0000 315780.53 315780.53 0.00 4741.81 4741.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.62 82.29% 4450.59 1634 5979 4444.65 4028 4811 220849 220849 0.00
crit 10.68 17.71% 8886.39 3267 11958 8869.12 5332 11095 94931 94931 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (201) 0.8% (1.2%) 7.3 37.06sec 8294 0 Direct 7.3 4925 9849 5804 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 0.0000 0.0000 42316.87 42316.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.99 82.14% 4924.62 4925 4925 4924.62 4925 4925 29491 29491 0.00
crit 1.30 17.86% 9849.24 9849 9849 7226.85 0 9849 12826 12826 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 37.06sec 2490 0 Direct 7.3 2111 4221 2490 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 0.0000 0.0000 18151.84 18151.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.98 82.03% 2110.55 2111 2111 2108.44 0 2111 12623 12623 0.00
crit 1.31 17.97% 4221.10 4221 4221 3125.93 0 4221 5529 5529 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1341 7.8% 95.7 3.06sec 4200 2812 Direct 95.1 3595 7188 4230 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.73 95.06 0.00 0.00 1.4937 0.0000 402042.06 402042.06 0.00 2811.62 2811.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.26 82.33% 3594.88 3373 4297 3595.46 3552 3652 281350 281350 0.00
crit 16.79 17.67% 7187.67 6745 8595 7188.92 6926 7561 120692 120692 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 291 1.7% 7.3 37.02sec 11884 0 Direct 7.2 10240 20481 12064 17.8%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 7.23 0.00 0.00 0.0000 0.0000 87241.42 87241.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.94 82.19% 10240.44 10240 10240 10236.34 0 10240 60865 60865 0.00
crit 1.29 17.81% 20480.88 20481 20481 14986.81 0 20481 26376 26376 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3143 / 3143
Firebolt 3143 18.2% 103.9 2.89sec 9068 6939 Direct 103.0 7775 15550 9140 17.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.86 103.04 0.00 0.00 1.3068 0.0000 941765.37 941765.37 0.00 6938.62 6938.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.95 82.45% 7775.10 7027 9401 7776.21 7634 7949 660518 660518 0.00
crit 18.09 17.55% 15550.01 14053 18802 15551.88 14495 16863 281247 281247 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - grimoire_felguard 4765 / 1032
Felstorm 652 0.8% 3.9 80.55sec 10645 3639 Periodic 19.5 1829 3661 2155 17.8% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 19.47 19.47 2.9254 0.5922 41965.75 59995.08 30.05 3639.07 3639.07
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.22% 1829.43 1715 2197 1829.97 1772 2039 29293 41878 30.05
crit 3.5 17.78% 3660.65 3430 4393 3576.00 0 4393 12673 18117 29.35
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1848 2.3% 18.4 13.90sec 6449 6449 Direct 18.4 5476 10960 6449 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.45 18.45 0.00 0.00 1.0000 0.0000 118968.30 170079.48 30.05 6449.20 6449.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.18 82.26% 5476.25 5020 6430 5478.71 5223 5935 83106 118810 30.05
crit 3.27 17.74% 10960.33 10040 12861 10675.94 0 12249 35862 51270 29.26
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2265 2.8% 40.9 6.36sec 3557 3007 Direct 40.9 3020 6043 3557 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.94 40.94 0.00 0.00 1.1830 0.0000 145645.56 208217.82 30.05 3007.09 3007.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.66 82.22% 3019.88 2744 3515 3020.68 2925 3232 101658 145332 30.05
crit 7.28 17.78% 6042.53 5488 7030 6038.88 0 6806 43988 62886 30.03
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - illidari_satyr 1278 / 172
melee 422 0.3% 42.7 2.53sec 391 332 Direct 42.7 332 664 391 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.69 42.69 0.00 0.00 1.1782 0.0000 16697.73 23871.41 30.05 332.02 332.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.12 82.27% 332.30 294 358 332.63 294 357 11670 16683 30.05
crit 7.57 17.73% 664.44 587 717 656.35 0 717 5028 7188 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 210 0.2% 42.7 2.53sec 195 157 Direct 42.7 166 332 195 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.69 42.69 0.00 0.00 1.2453 0.0000 8340.23 11923.35 30.05 156.91 156.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.17 82.40% 166.14 147 179 166.30 147 178 5843 8354 30.05
crit 7.51 17.60% 332.35 294 358 327.64 0 358 2497 3569 29.60
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 646 0.5% 9.1 12.10sec 2821 2821 Direct 9.1 2395 4790 2821 17.8%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.15 9.15 0.00 0.00 1.0000 0.0000 25807.80 25807.80 0.00 2821.45 2821.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.52 82.20% 2395.02 2116 2582 2395.22 0 2582 18010 18010 0.00
crit 1.63 17.80% 4790.30 4233 5163 3606.69 0 5163 7798 7798 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vilefiend 3204 / 1518
Bile Spit 1165 3.2% 6.8 47.22sec 24274 0 Direct 6.8 8926 17844 10492 17.6%  
Periodic 33.1 2823 0 2823 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 6.77 33.15 33.15 0.0000 2.0000 164616.56 164616.56 0.00 2483.02 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.58 82.44% 8925.94 8474 10104 8925.21 8505 9664 49830 49830 0.00
crit 1.19 17.56% 17843.61 16947 20207 13041.98 0 20207 21213 21213 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.1 100.00% 2822.84 2502 3310 2823.41 2633 2885 93573 93573 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.0% 28.6 10.23sec 3651 3651 Direct 28.6 3106 6211 3651 17.5%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.56 28.56 0.00 0.00 1.0000 0.0000 104272.42 149069.94 30.05 3650.61 3650.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.55 82.46% 3105.87 2737 3621 3107.27 2890 3249 73155 104583 30.05
crit 5.01 17.54% 6211.49 5474 7243 6186.05 0 7243 31118 44487 29.93
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1306 3.6% 103.0 2.81sec 1801 1353 Direct 103.0 1531 3063 1801 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.95 102.95 0.00 0.00 1.3308 0.0000 185439.24 265107.66 30.05 1353.42 1353.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.78 82.34% 1530.62 1337 1775 1531.16 1475 1573 129759 185505 30.05
crit 18.18 17.66% 3062.90 2673 3550 3063.59 2850 3325 55681 79602 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - urzul 1339 / 179
Many Faced Bite 498 0.4% 9.4 11.98sec 2109 2109 Direct 9.4 1793 3590 2109 17.6%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.40 9.40 0.00 0.00 1.0000 0.0000 19817.66 28331.73 30.05 2108.93 2108.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.75 82.42% 1792.83 1586 1935 1793.33 0 1935 13886 19852 29.99
crit 1.65 17.58% 3589.52 3172 3870 2746.01 0 3870 5931 8480 22.97
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 840 0.6% 42.4 2.59sec 783 667 Direct 42.4 665 1330 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.44 42.44 0.00 0.00 1.1750 0.0000 33234.55 47512.78 30.05 666.53 666.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.90 82.24% 665.00 587 717 666.03 587 714 23209 33180 30.05
crit 7.54 17.76% 1330.28 1175 1433 1309.72 0 1433 10026 14333 29.55
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3642 / 2408
Dreadbite 1334 5.1% 29.1 20.93sec 9084 0 Direct 29.1 7717 15440 9084 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.10 29.10 0.00 0.00 0.0000 0.0000 264326.15 264326.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.95 82.30% 7716.94 7139 9517 7717.13 7463 8043 184797 184797 0.00
crit 5.15 17.70% 15439.98 14278 19033 15372.10 0 19033 79530 79530 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2307 8.8% 312.6 1.89sec 1464 1106 Direct 312.6 1244 2488 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.56 312.56 0.00 0.00 1.3235 0.0000 457503.11 654055.63 30.05 1106.00 1106.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.29 82.32% 1243.81 1101 1473 1243.99 1225 1265 320025 457514 30.05
crit 55.26 17.68% 2487.66 2203 2947 2487.90 2395 2606 137478 196541 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 2576 / 2476
Fel Firebolt 2576 14.4% 995.0 0.29sec 747 502 Direct 990.9 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 995.04 990.94 0.00 0.00 1.4873 0.0000 742846.09 742846.09 0.00 501.96 501.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 815.60 82.31% 636.97 569 761 636.98 626 649 519512 519512 0.00
crit 175.34 17.69% 1273.73 1138 1523 1273.75 1237 1311 223334 223334 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4661 / 824
Demonfire 4661 4.8% 37.7 6.94sec 6530 4891 Direct 37.7 5561 11122 6544 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.75 37.67 0.00 0.00 1.3352 0.0000 246513.67 246513.67 0.00 4890.85 4890.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.01 82.31% 5560.64 5312 5917 5563.93 5465 5684 172414 172414 0.00
crit 6.66 17.69% 11121.81 10624 11834 11124.46 0 11834 74100 74100 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1724 / 233
melee 837 0.6% 42.6 2.57sec 783 666 Direct 42.6 665 1330 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.63 42.63 0.00 0.00 1.1759 0.0000 33367.48 47702.83 30.05 665.73 665.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.06 82.26% 664.80 587 717 665.53 587 715 23310 33324 30.05
crit 7.56 17.74% 1329.98 1175 1433 1313.94 0 1433 10058 14379 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 419 0.3% 42.6 2.57sec 392 315 Direct 42.6 332 665 392 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.63 42.63 0.00 0.00 1.2432 0.0000 16688.88 23858.76 30.05 314.94 314.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.05 82.22% 332.42 294 358 332.79 294 357 11650 16655 30.05
crit 7.58 17.78% 664.79 587 717 657.43 0 717 5039 7204 29.69
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 467 0.4% 8.9 12.75sec 2115 2115 Direct 8.9 1795 3588 2115 17.8%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.90 8.90 0.00 0.00 1.0000 0.0000 18824.24 26911.51 30.05 2114.61 2114.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.32 82.19% 1795.17 1586 1935 1797.26 0 1935 13135 18778 30.02
crit 1.59 17.81% 3588.45 3172 3870 2695.31 0 3870 5689 8133 22.55
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - shivarra 1954 / 263
melee 845 0.6% 42.9 2.62sec 782 666 Direct 42.9 665 1330 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.89 42.89 0.00 0.00 1.1740 0.0000 33551.64 47966.09 30.05 666.35 666.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.32 82.36% 664.97 587 717 665.96 587 714 23488 33579 30.05
crit 7.57 17.64% 1330.07 1175 1433 1310.93 0 1433 10064 14387 29.59
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 423 0.3% 42.9 2.62sec 391 315 Direct 42.9 332 665 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.89 42.89 0.00 0.00 1.2413 0.0000 16780.80 23990.18 30.05 315.21 315.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.31 82.32% 332.48 294 358 332.97 294 357 11739 16782 30.05
crit 7.58 17.68% 665.07 587 717 656.51 0 717 5042 7208 29.62
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (93) 0.0% (0.5%) 0.0 0.00sec 0 3965

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3965.12 3965.12
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 172 0.1% 6.9 17.51sec 992 0 Direct 6.9 844 1690 992 17.6%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 0.0000 0.0000 6859.79 9806.90 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.70 82.45% 843.81 749 914 842.88 0 914 4810 6876 29.95
crit 1.21 17.55% 1689.71 1498 1827 1137.65 0 1827 2050 2931 20.22
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 171 0.1% 6.9 17.51sec 989 0 Direct 6.9 844 1688 988 17.1%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 0.0000 0.0000 6833.85 9769.81 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.73 82.87% 844.05 749 914 842.00 0 914 4836 6913 29.91
crit 1.18 17.13% 1687.52 1498 1827 1124.76 0 1827 1998 2857 20.01
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 171 0.1% 6.9 17.51sec 991 0 Direct 6.9 844 1688 990 17.4%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 0.0000 0.0000 6847.96 9789.99 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.71 82.63% 844.04 749 914 843.43 0 914 4821 6893 29.96
crit 1.20 17.37% 1687.62 1498 1827 1120.52 0 1827 2027 2897 19.92
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 172 0.1% 6.9 17.51sec 994 0 Direct 6.9 844 1686 994 17.8%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 0.0000 0.0000 6869.28 9820.47 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.69 82.24% 844.24 749 914 841.62 0 914 4800 6862 29.89
crit 1.23 17.76% 1685.72 1498 1827 1148.79 0 1827 2069 2958 20.47
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1837 / 246
Double Breath 0 (134) 0.0% (0.8%) 0.0 0.00sec 0 7417

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7416.53 7416.53
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 497 0.4% 7.0 16.75sec 2817 0 Direct 7.0 2388 4778 2817 17.9%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 19797.21 19797.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.77 82.05% 2387.89 2116 2582 2385.08 0 2582 13770 13770 0.00
crit 1.26 17.95% 4777.75 4233 5163 3275.12 0 5163 6027 6027 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 496 0.4% 7.0 16.75sec 2810 0 Direct 7.0 2388 4780 2810 17.6%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.0000 0.0000 19747.75 19747.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.79 82.35% 2387.69 2116 2582 2381.24 0 2582 13820 13820 0.00
crit 1.24 17.65% 4779.68 4233 5163 3208.60 0 5163 5928 5928 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 845 0.6% 42.7 2.59sec 783 666 Direct 42.7 665 1329 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.72 42.72 0.00 0.00 1.1753 0.0000 33437.14 47802.41 30.05 665.92 665.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.13 82.24% 664.69 587 717 665.36 587 714 23352 33385 30.05
crit 7.59 17.76% 1328.78 1175 1433 1308.88 0 1433 10085 14417 29.57
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1066 / 143
Demon Fangs 657 0.5% 9.3 12.48sec 2819 2819 Direct 9.3 2394 4786 2818 17.7%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.29 9.29 0.00 0.00 1.0000 0.0000 26188.13 26188.13 0.00 2818.66 2818.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.64 82.25% 2393.98 2116 2582 2398.05 0 2582 18295 18295 0.00
crit 1.65 17.75% 4786.35 4233 5163 3654.07 0 5163 7894 7894 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 409 0.3% 82.4 1.35sec 196 326 Direct 82.4 167 333 196 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.43 82.43 0.00 0.00 0.6006 0.0000 16160.41 23103.24 30.05 326.41 326.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.87 82.33% 166.61 147 179 166.78 147 178 11307 16165 30.05
crit 14.57 17.67% 333.15 294 358 332.87 0 358 4854 6939 30.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - bilescourge 3927 / 526
Toxic Bile 3927 3.0% 55.2 1.99sec 2823 3025 Direct 55.2 2400 4796 2823 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.22 55.22 0.00 0.00 0.9332 0.0000 155896.79 155896.79 0.00 3025.18 3025.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.48 82.36% 2400.25 2116 2582 2402.01 2116 2569 109169 109169 0.00
crit 9.74 17.64% 4796.36 4233 5163 4757.26 0 5163 46728 46728 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - darkhound 1303 / 175
Fel Bite 467 0.4% 8.8 13.20sec 2114 2114 Direct 8.8 1795 3592 2114 17.7%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.85 8.85 0.00 0.00 1.0000 0.0000 18706.38 26743.02 30.05 2113.95 2113.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.28 82.26% 1795.08 1586 1935 1792.93 0 1935 13068 18683 29.95
crit 1.57 17.74% 3591.89 3172 3870 2683.69 0 3870 5638 8060 22.43
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 836 0.6% 42.4 2.67sec 782 666 Direct 42.4 665 1329 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.41 42.41 0.00 0.00 1.1739 0.0000 33177.17 47430.74 30.05 666.49 666.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.92 82.33% 664.96 587 717 665.90 587 714 23218 33192 30.05
crit 7.49 17.67% 1329.48 1175 1433 1310.30 0 1433 9960 14238 29.57
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - prince_malchezaar 4699 / 400
melee 3137 1.5% 21.4 1.42sec 3717 3138 Direct 21.4 3148 6290 3717 18.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.39 21.39 0.00 0.00 1.1846 0.0000 79526.40 113692.53 30.05 3138.13 3138.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.52 81.89% 3148.38 2784 3396 3157.32 2784 3380 55157 78854 30.05
crit 3.87 18.11% 6289.67 5567 6791 6143.75 0 6791 24369 34839 29.28
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1561 0.8% 21.4 1.42sec 1851 1479 Direct 21.4 1573 3152 1851 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.39 21.39 0.00 0.00 1.2514 0.0000 39596.66 56608.18 30.05 1479.09 1479.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.63 82.42% 1573.45 1392 1698 1578.03 1392 1691 27745 39665 30.05
crit 3.76 17.58% 3151.70 2784 3396 3079.57 0 3396 11851 16943 29.28
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 993 / 84
Eye of Gul'dan 993 0.5% 28.2 4.36sec 871 1144 Periodic 61.3 400 0 400 0.0% 60.0%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.17 0.00 61.30 61.30 0.7613 2.9376 24539.79 24539.79 0.00 121.76 1144.15
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.3 100.00% 400.29 181 461 399.35 379 405 24540 24540 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DL_GF_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.37sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.93sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 1.2015 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.74sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1274 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2388 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.53sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 1.5119 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 15.1 14.69sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.13 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.22sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 0.00 0.00 0.00 1.5404 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.17sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 8.42% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.5 23.2sec 10.2sec 51.79% 83.75% 15.5(15.5) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.79%

Trigger Attempt Success

  • trigger_pct:20.06%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.4 30.1 12.3sec 5.3sec 38.62% 100.00% 4.4(4.4) 0.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.82%
  • demonic_core_2:15.69%
  • demonic_core_3:4.99%
  • demonic_core_4:2.12%

Trigger Attempt Success

  • trigger_pct:25.75%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.68% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.7 26.7sec 10.1sec 66.12% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.64%
  • dreadstalkers_4:6.48%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.5 180.6sec 2.2sec 1.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.7sec 120.7sec 19.75% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.86% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 66.9sec 36.5sec 44.02% 0.00% 3.0(41.3) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.34%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.77%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.92%
  • overwhelming_power_17:1.97%
  • overwhelming_power_18:2.02%
  • overwhelming_power_19:2.08%
  • overwhelming_power_20:2.14%
  • overwhelming_power_21:2.21%
  • overwhelming_power_22:2.27%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.1 182.8sec 14.7sec 19.60% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.02%
  • portal_summons_2:0.76%
  • portal_summons_3:1.26%
  • portal_summons_4:1.96%
  • portal_summons_5:1.38%
  • portal_summons_6:1.77%
  • portal_summons_7:4.34%
  • portal_summons_8:6.08%
  • portal_summons_9:0.04%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 182.1sec 85.1sec 1.20% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.5 52.1sec 10.3sec 67.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.74%
  • quick_navigation_2:17.14%
  • quick_navigation_3:16.56%
  • quick_navigation_4:16.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.4 0.0 52.0sec 52.0sec 17.58% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 79.9sec 17.07% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.68% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.50% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.50%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.8 55.6sec 0.0sec 96.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.30%
  • wild_imps_2:2.76%
  • wild_imps_3:28.82%
  • wild_imps_4:7.66%
  • wild_imps_5:9.52%
  • wild_imps_6:26.06%
  • wild_imps_7:5.82%
  • wild_imps_8:4.00%
  • wild_imps_9:4.79%
  • wild_imps_10:1.49%
  • wild_imps_11:1.15%
  • wild_imps_12:1.08%
  • wild_imps_13:0.42%
  • wild_imps_14:0.18%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
  • wild_imps_18:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.7sec 120.7sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.1 13.9sec
one_shard_hog 8.8 21.7sec
two_shard_hog 3.8 16.7sec
three_shard_hog 47.8 5.8sec
portal_summon 15.1 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_GF_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 45.2 90370.6 2000.0 2045.2 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.4 159.8 2.6 2.6 1976.2
shadow_bolt Mana 95.7 191462.7 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7202.1 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.9 4154.4 40.0 40.0 226.7
pet - grimoire_felguard
felstorm Energy 3.9 236.5 60.0 60.0 177.4
legion_strike Energy 18.4 1106.9 60.0 60.0 107.5
pet - wild_imp
fel_firebolt Energy 995.0 15599.8 15.7 15.7 47.6
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.19 90.36 (48.56%) 2.00 0.01 0.01%
shadow_bolt Soul Shard 95.73 95.73 (51.44%) 1.00 0.00 0.00%
mana_regen Mana 554.46 286348.82 (100.00%) 516.44 13106.60 4.38%
pet - imp
energy_regen Energy 427.54 3983.61 (100.00%) 9.32 22.74 0.57%
pet - grimoire_felguard
energy_regen Energy 91.66 914.17 (100.00%) 9.97 48.45 5.03%
pet - demonic_tyrant
energy_regen Energy 37.75 0.00 (0.00%) 0.00 762.18 100.00%
pet - bilescourge
energy_regen Energy 13.66 0.00 (0.00%) 0.00 189.63 100.00%
pet - bilescourge
energy_regen Energy 11.79 0.00 (0.00%) 0.00 164.59 100.00%
pet - bilescourge
energy_regen Energy 13.65 0.00 (0.00%) 0.00 190.15 100.00%
pet - bilescourge
energy_regen Energy 6.33 0.00 (0.00%) 0.00 88.36 100.00%
pet - bilescourge
energy_regen Energy 5.84 0.00 (0.00%) 0.00 81.48 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.47 963.42
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97304.84 93009.00 100000.00
Soul Shard 2.58 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%

Statistics & Data Analysis

Fight Length
Sample Data DL_GF_Imp Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_GF_Imp Damage Per Second
Count 4999
Mean 17275.55
Minimum 15564.21
Maximum 19716.13
Spread ( max - min ) 4151.92
Range [ ( max - min ) / 2 * 100% ] 12.02%
Standard Deviation 577.2389
5th Percentile 16382.07
95th Percentile 18291.70
( 95th Percentile - 5th Percentile ) 1909.63
Mean Distribution
Standard Deviation 8.1642
95.00% Confidence Intervall ( 17259.54 - 17291.55 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4289
0.1 Scale Factor Error with Delta=300 2845
0.05 Scale Factor Error with Delta=300 11378
0.01 Scale Factor Error with Delta=300 284443
Priority Target DPS
Sample Data DL_GF_Imp Priority Target Damage Per Second
Count 4999
Mean 17275.55
Minimum 15564.21
Maximum 19716.13
Spread ( max - min ) 4151.92
Range [ ( max - min ) / 2 * 100% ] 12.02%
Standard Deviation 577.2389
5th Percentile 16382.07
95th Percentile 18291.70
( 95th Percentile - 5th Percentile ) 1909.63
Mean Distribution
Standard Deviation 8.1642
95.00% Confidence Intervall ( 17259.54 - 17291.55 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4289
0.1 Scale Factor Error with Delta=300 2845
0.05 Scale Factor Error with Delta=300 11378
0.01 Scale Factor Error with Delta=300 284443
DPS(e)
Sample Data DL_GF_Imp Damage Per Second (Effective)
Count 4999
Mean 17275.55
Minimum 15564.21
Maximum 19716.13
Spread ( max - min ) 4151.92
Range [ ( max - min ) / 2 * 100% ] 12.02%
Damage
Sample Data DL_GF_Imp Damage
Count 4999
Mean 1242353.40
Minimum 878030.68
Maximum 1630713.72
Spread ( max - min ) 752683.04
Range [ ( max - min ) / 2 * 100% ] 30.29%
DTPS
Sample Data DL_GF_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_GF_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_GF_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_GF_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_GF_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_GF_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_GF_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_GF_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.81 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.59 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.63 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.50 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.39 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.24 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.68 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.95 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.79 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.90 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKKKKKHFIHIKHKKIHIHKIHIKKKHFIIEHKKHKKIHIKKHFKKHIKHKKKHKKKKFHIIKEG8HIHKKKKFHKKKHIIHIHIDIIHFIHKIHKIKKEHIIHFKKHKIHKKKKKaKKYZKKKKKXSSVSVST9AVPQVSKSKKKHKIHIIKHIFHIKHKKKHIIHKIKHFKKEKHKDKIHIKKKFHKKHKKKHIKIHIFHIKGKKEHIHKKKKFHI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.277 nether_portal_active O grimoire_felguard Fluffy_Pillow 99277.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.259 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.567 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:04.875 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:05.852 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.153 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.153 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.153 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.249 nether_portal_active S hand_of_guldan Fluffy_Pillow 97101.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.066 build_a_shard K shadow_bolt Fluffy_Pillow 97918.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.151 nether_portal_active S hand_of_guldan Fluffy_Pillow 97003.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.967 build_a_shard K shadow_bolt Fluffy_Pillow 97819.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.054 nether_portal_active S hand_of_guldan Fluffy_Pillow 96906.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.846 build_a_shard K shadow_bolt Fluffy_Pillow 97698.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.900 nether_portal_active S hand_of_guldan Fluffy_Pillow 96752.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation(3), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.688 build_a_shard K shadow_bolt Fluffy_Pillow 97540.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.735 nether_portal_active S hand_of_guldan Fluffy_Pillow 96587.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.497 build_a_shard K shadow_bolt Fluffy_Pillow 97349.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.514 nether_portal_active S hand_of_guldan Fluffy_Pillow 96366.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.392 build_a_shard K shadow_bolt Fluffy_Pillow 97244.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.560 build_a_shard K shadow_bolt Fluffy_Pillow 96412.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.692 build_a_shard K shadow_bolt Fluffy_Pillow 95544.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.824 build_a_shard K shadow_bolt Fluffy_Pillow 94676.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.956 build_a_shard K shadow_bolt Fluffy_Pillow 93808.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:24.089 default H hand_of_guldan Fluffy_Pillow 92941.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), ignition_mages_fuse(5)
0:24.914 default F call_dreadstalkers Fluffy_Pillow 93766.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.739 default I demonbolt Fluffy_Pillow 94591.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.566 default H hand_of_guldan Fluffy_Pillow 93418.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(24), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.319 default I demonbolt Fluffy_Pillow 94171.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(23), archive_of_the_titans(6)
0:28.168 build_a_shard K shadow_bolt Fluffy_Pillow 93020.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(6)
0:29.301 default H hand_of_guldan Fluffy_Pillow 92153.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(21), archive_of_the_titans(6)
0:30.155 build_a_shard K shadow_bolt Fluffy_Pillow 93007.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(3), overwhelming_power(20), archive_of_the_titans(7)
0:31.302 build_a_shard K shadow_bolt Fluffy_Pillow 92154.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, quick_navigation(3), overwhelming_power(19), archive_of_the_titans(7)
0:32.453 default I demonbolt Fluffy_Pillow 91305.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(18), archive_of_the_titans(7)
0:33.318 default H hand_of_guldan Fluffy_Pillow 90170.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(17), archive_of_the_titans(7)
0:34.188 default I demonbolt Fluffy_Pillow 91040.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(7)
0:35.062 default H hand_of_guldan Fluffy_Pillow 89914.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(8)
0:35.942 build_a_shard K shadow_bolt Fluffy_Pillow 90794.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(8)
0:37.114 default I demonbolt Fluffy_Pillow 89966.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), quick_navigation(4), overwhelming_power(13), archive_of_the_titans(8)
0:38.002 default H hand_of_guldan Fluffy_Pillow 88854.0/100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(12), archive_of_the_titans(8)
0:38.896 default I demonbolt Fluffy_Pillow 89748.0/100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(12), archive_of_the_titans(8)
0:39.791 build_a_shard K shadow_bolt Fluffy_Pillow 88643.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(11), archive_of_the_titans(8)
0:40.989 build_a_shard K shadow_bolt Fluffy_Pillow 87841.0/100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(9), quick_navigation(4), overwhelming_power(10), archive_of_the_titans(9)
0:42.193 build_a_shard K shadow_bolt Fluffy_Pillow 87045.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(8), archive_of_the_titans(9)
0:43.775 default H hand_of_guldan Fluffy_Pillow 86627.0/100000: 87% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(4), overwhelming_power(7), archive_of_the_titans(9)
0:44.969 default F call_dreadstalkers Fluffy_Pillow 87821.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), overwhelming_power(6), archive_of_the_titans(9)
0:46.171 default I demonbolt Fluffy_Pillow 89023.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(4), archive_of_the_titans(10)
0:47.388 default I demonbolt Fluffy_Pillow 88240.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(3), archive_of_the_titans(10)
0:48.610 default E summon_vilefiend Fluffy_Pillow 87462.0/100000: 87% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(2), archive_of_the_titans(10)
0:50.250 default H hand_of_guldan Fluffy_Pillow 89102.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(11)
0:51.498 build_a_shard K shadow_bolt Fluffy_Pillow 90350.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(11)
0:52.882 build_a_shard K shadow_bolt Fluffy_Pillow 89734.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(11)
0:54.272 default H hand_of_guldan Fluffy_Pillow 89124.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(11)
0:55.324 build_a_shard K shadow_bolt Fluffy_Pillow 90176.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(12)
0:56.736 build_a_shard K shadow_bolt Fluffy_Pillow 89588.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(20), archive_of_the_titans(12)
0:58.153 default I demonbolt Fluffy_Pillow 89005.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(12)
0:59.226 default H hand_of_guldan Fluffy_Pillow 88078.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(12)
1:00.308 default I demonbolt Fluffy_Pillow 89160.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(13)
1:01.395 build_a_shard K shadow_bolt Fluffy_Pillow 88247.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(13)
1:02.851 build_a_shard K shadow_bolt Fluffy_Pillow 87703.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation, overwhelming_power(14), archive_of_the_titans(13)
1:04.407 default H hand_of_guldan Fluffy_Pillow 87259.0/100000: 87% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation, overwhelming_power(12), archive_of_the_titans(13)
1:05.587 default F call_dreadstalkers Fluffy_Pillow 88439.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(11), archive_of_the_titans(14)
1:06.773 build_a_shard K shadow_bolt Fluffy_Pillow 89625.0/100000: 90% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(10), archive_of_the_titans(14)
1:08.364 build_a_shard K shadow_bolt Fluffy_Pillow 89216.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(8), archive_of_the_titans(14)
1:09.974 default H hand_of_guldan Fluffy_Pillow 88826.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(7), archive_of_the_titans(14)
1:11.188 default I demonbolt Fluffy_Pillow 90040.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(5), archive_of_the_titans(15)
1:12.418 build_a_shard K shadow_bolt Fluffy_Pillow 89270.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(4), archive_of_the_titans(15)
1:14.067 default H hand_of_guldan Fluffy_Pillow 88919.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(2), archive_of_the_titans(15)
1:15.321 build_a_shard K shadow_bolt Fluffy_Pillow 90173.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power, archive_of_the_titans(16)
1:17.000 build_a_shard K shadow_bolt Fluffy_Pillow 89852.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(16)
1:18.690 build_a_shard K shadow_bolt Fluffy_Pillow 89542.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(16)
1:20.379 default H hand_of_guldan Fluffy_Pillow 89231.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(17)
1:21.646 build_a_shard K shadow_bolt Fluffy_Pillow 90498.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(17)
1:23.327 build_a_shard K shadow_bolt Fluffy_Pillow 90179.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), archive_of_the_titans(17)
1:25.008 build_a_shard K shadow_bolt Fluffy_Pillow 89860.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(3), archive_of_the_titans(18)
1:26.679 build_a_shard K shadow_bolt Fluffy_Pillow 89531.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(18)
1:28.350 default F call_dreadstalkers Fluffy_Pillow 89202.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(18)
1:29.602 default H hand_of_guldan Fluffy_Pillow 90454.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(18)
1:30.855 default I demonbolt Fluffy_Pillow 91707.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:32.106 default I demonbolt Fluffy_Pillow 90958.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps, dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:33.359 build_a_shard K shadow_bolt Fluffy_Pillow 90211.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:35.027 default E summon_vilefiend Fluffy_Pillow 89879.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
1:36.904 default G summon_demonic_tyrant Fluffy_Pillow 91756.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
1:38.807 default 8 potion Fluffy_Pillow 91659.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
1:38.807 default H hand_of_guldan Fluffy_Pillow 91659.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:40.053 default I demonbolt Fluffy_Pillow 92905.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:41.300 default H hand_of_guldan Fluffy_Pillow 92152.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:42.545 build_a_shard K shadow_bolt Fluffy_Pillow 93397.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:43.987 build_a_shard K shadow_bolt Fluffy_Pillow 92839.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
1:45.436 build_a_shard K shadow_bolt Fluffy_Pillow 92288.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect
1:46.838 build_a_shard K shadow_bolt Fluffy_Pillow 91690.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
1:48.249 default F call_dreadstalkers Fluffy_Pillow 91101.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
1:49.421 default H hand_of_guldan Fluffy_Pillow 92273.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
1:50.495 build_a_shard K shadow_bolt Fluffy_Pillow 93347.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
1:51.934 build_a_shard K shadow_bolt Fluffy_Pillow 92786.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
1:53.382 build_a_shard K shadow_bolt Fluffy_Pillow 92234.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
1:54.845 default H hand_of_guldan Fluffy_Pillow 91697.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
1:55.951 default I demonbolt Fluffy_Pillow 92803.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
1:57.140 default I demonbolt Fluffy_Pillow 91992.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect
1:58.340 default H hand_of_guldan Fluffy_Pillow 91192.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, overwhelming_power(9), archive_of_the_titans(20), battle_potion_of_intellect
1:59.547 default I demonbolt Fluffy_Pillow 92399.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect
2:00.763 default H hand_of_guldan Fluffy_Pillow 91615.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(11), vilefiend, overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect
2:01.986 default I demonbolt Fluffy_Pillow 92838.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(6), vilefiend, overwhelming_power(6), archive_of_the_titans(20), battle_potion_of_intellect
2:03.216 default D grimoire_felguard Fluffy_Pillow 92068.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), vilefiend, overwhelming_power(4), archive_of_the_titans(20), battle_potion_of_intellect
2:04.460 default I demonbolt Fluffy_Pillow 93312.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(9), vilefiend, grimoire_felguard, overwhelming_power(3), archive_of_the_titans(20)
2:05.714 default I demonbolt Fluffy_Pillow 92566.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), vilefiend, grimoire_felguard, overwhelming_power(2), archive_of_the_titans(20)
2:06.974 default H hand_of_guldan Fluffy_Pillow 91826.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), grimoire_felguard, overwhelming_power, archive_of_the_titans(20)
2:08.242 default F call_dreadstalkers Fluffy_Pillow 93094.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:09.620 default I demonbolt Fluffy_Pillow 94472.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:10.888 default H hand_of_guldan Fluffy_Pillow 93740.0/100000: 94% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:12.157 build_a_shard K shadow_bolt Fluffy_Pillow 95009.0/100000: 95% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:13.846 default I demonbolt Fluffy_Pillow 94698.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:15.115 default H hand_of_guldan Fluffy_Pillow 93967.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:16.383 build_a_shard K shadow_bolt Fluffy_Pillow 95235.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:18.072 default I demonbolt Fluffy_Pillow 94924.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:19.341 build_a_shard K shadow_bolt Fluffy_Pillow 94193.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:21.030 build_a_shard K shadow_bolt Fluffy_Pillow 93882.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
2:22.493 default E summon_vilefiend Fluffy_Pillow 93345.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
2:23.965 default H hand_of_guldan Fluffy_Pillow 94817.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
2:25.077 default I demonbolt Fluffy_Pillow 95929.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
2:26.199 default I demonbolt Fluffy_Pillow 95051.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps, vilefiend, quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
2:27.326 default H hand_of_guldan Fluffy_Pillow 94178.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
2:28.430 default F call_dreadstalkers Fluffy_Pillow 95282.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
2:29.540 build_a_shard K shadow_bolt Fluffy_Pillow 96392.0/100000: 96% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
2:31.028 build_a_shard K shadow_bolt Fluffy_Pillow 95880.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
2:32.522 default H hand_of_guldan Fluffy_Pillow 95374.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
2:33.651 build_a_shard K shadow_bolt Fluffy_Pillow 96503.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20)
2:35.163 default I demonbolt Fluffy_Pillow 96015.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20)
2:36.304 default H hand_of_guldan Fluffy_Pillow 95156.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
2:37.449 build_a_shard K shadow_bolt Fluffy_Pillow 96301.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20)
2:38.986 build_a_shard K shadow_bolt Fluffy_Pillow 95838.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
2:40.531 build_a_shard K shadow_bolt Fluffy_Pillow 95383.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
2:42.096 build_a_shard K shadow_bolt Fluffy_Pillow 94948.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
2:43.679 build_a_shard K shadow_bolt Fluffy_Pillow 94531.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(8), archive_of_the_titans(20)
2:45.271 nether_portal_building a hand_of_guldan Fluffy_Pillow 94123.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
2:46.479 build_a_shard K shadow_bolt Fluffy_Pillow 95331.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(20)
2:48.101 build_a_shard K shadow_bolt Fluffy_Pillow 94953.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation(4), overwhelming_power(3), archive_of_the_titans(20)
2:49.729 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 94581.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(2), archive_of_the_titans(20)
2:50.903 nether_portal_building Z hand_of_guldan Fluffy_Pillow 95755.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power, archive_of_the_titans(20)
2:52.082 build_a_shard K shadow_bolt Fluffy_Pillow 96934.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:53.665 build_a_shard K shadow_bolt Fluffy_Pillow 96517.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:55.249 build_a_shard K shadow_bolt Fluffy_Pillow 96101.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:56.831 build_a_shard K shadow_bolt Fluffy_Pillow 95683.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:58.415 build_a_shard K shadow_bolt Fluffy_Pillow 95267.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:59.998 nether_portal_building X nether_portal Fluffy_Pillow 94850.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:01.276 nether_portal_active S hand_of_guldan Fluffy_Pillow 96128.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), portal_summons, archive_of_the_titans(20)
3:02.553 nether_portal_active S hand_of_guldan Fluffy_Pillow 97405.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, portal_summons(2), archive_of_the_titans(20)
3:03.831 nether_portal_active V demonbolt Fluffy_Pillow 98683.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps, portal_summons(3), archive_of_the_titans(20)
3:05.107 nether_portal_active S hand_of_guldan Fluffy_Pillow 97959.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), archive_of_the_titans(20)
3:06.383 nether_portal_active V demonbolt Fluffy_Pillow 99235.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(5), portal_summons(4), archive_of_the_titans(20)
3:07.659 nether_portal_active S hand_of_guldan Fluffy_Pillow 98511.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(6), portal_summons(4), archive_of_the_titans(20)
3:08.938 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 99790.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(7), portal_summons(5), archive_of_the_titans(20)
3:10.637 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), archive_of_the_titans(20)
3:10.637 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), archive_of_the_titans(20), ignition_mages_fuse
3:10.637 nether_portal_active V demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), archive_of_the_titans(20), ignition_mages_fuse
3:11.708 nether_portal_active P summon_vilefiend Fluffy_Pillow 97074.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), archive_of_the_titans(20), ignition_mages_fuse
3:13.138 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 98504.0/100000: 99% mana | 1.0/5: 20% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(8), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:14.206 nether_portal_active V demonbolt Fluffy_Pillow 99572.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:15.273 nether_portal_active S hand_of_guldan Fluffy_Pillow 98639.0/100000: 99% mana | 2.0/5: 40% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(2)
3:16.306 build_a_shard K shadow_bolt Fluffy_Pillow 99672.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(2)
3:17.681 nether_portal_active S hand_of_guldan Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.714 build_a_shard K shadow_bolt Fluffy_Pillow 99036.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(3)
3:20.047 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(3)
3:21.380 build_a_shard K shadow_bolt Fluffy_Pillow 97337.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(3)
3:22.904 default H hand_of_guldan Fluffy_Pillow 96861.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(4)
3:24.009 build_a_shard K shadow_bolt Fluffy_Pillow 97966.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(4)
3:25.480 default I demonbolt Fluffy_Pillow 97437.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(12), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(4)
3:26.585 default H hand_of_guldan Fluffy_Pillow 96542.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(14), vilefiend, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.689 default I demonbolt Fluffy_Pillow 97646.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(12), vilefiend, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(5)
3:28.763 default I demonbolt Fluffy_Pillow 96720.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(10), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(5)
3:29.836 build_a_shard K shadow_bolt Fluffy_Pillow 95793.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(13), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.264 default H hand_of_guldan Fluffy_Pillow 95221.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), quick_navigation(3), archive_of_the_titans(20)
3:32.517 default I demonbolt Fluffy_Pillow 96474.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
3:33.763 default F call_dreadstalkers Fluffy_Pillow 95720.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(4), quick_navigation(4), archive_of_the_titans(20)
3:35.009 default H hand_of_guldan Fluffy_Pillow 96966.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:36.255 default I demonbolt Fluffy_Pillow 98212.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:37.502 build_a_shard K shadow_bolt Fluffy_Pillow 97459.0/100000: 97% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:39.163 default H hand_of_guldan Fluffy_Pillow 97120.0/100000: 97% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:40.352 build_a_shard K shadow_bolt Fluffy_Pillow 98309.0/100000: 98% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:41.935 build_a_shard K shadow_bolt Fluffy_Pillow 97892.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:43.518 build_a_shard K shadow_bolt Fluffy_Pillow 97475.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:45.100 default H hand_of_guldan Fluffy_Pillow 97057.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
3:46.136 default I demonbolt Fluffy_Pillow 98093.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(4), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
3:47.180 default I demonbolt Fluffy_Pillow 97137.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(3), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
3:48.228 default H hand_of_guldan Fluffy_Pillow 96185.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(6), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
3:49.280 build_a_shard K shadow_bolt Fluffy_Pillow 97237.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(4), overwhelming_power(21), archive_of_the_titans(20)
3:50.783 default I demonbolt Fluffy_Pillow 96740.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
3:51.911 build_a_shard K shadow_bolt Fluffy_Pillow 95868.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
3:53.423 default H hand_of_guldan Fluffy_Pillow 95380.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
3:54.565 default F call_dreadstalkers Fluffy_Pillow 96522.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
3:55.712 build_a_shard K shadow_bolt Fluffy_Pillow 97669.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
3:57.250 build_a_shard K shadow_bolt Fluffy_Pillow 97207.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
3:58.797 default E summon_vilefiend Fluffy_Pillow 96754.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(12), archive_of_the_titans(20)
4:00.353 build_a_shard K shadow_bolt Fluffy_Pillow 98310.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20)
4:01.927 default H hand_of_guldan Fluffy_Pillow 97884.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
4:03.116 build_a_shard K shadow_bolt Fluffy_Pillow 99073.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(7), archive_of_the_titans(20)
4:04.707 default D grimoire_felguard Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
4:05.854 build_a_shard K shadow_bolt Fluffy_Pillow 99151.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
4:07.391 default I demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
4:08.560 default H hand_of_guldan Fluffy_Pillow 97173.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(2), archive_of_the_titans(20)
4:09.736 default I demonbolt Fluffy_Pillow 98349.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power, archive_of_the_titans(20)
4:10.918 build_a_shard K shadow_bolt Fluffy_Pillow 97531.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:12.499 build_a_shard K shadow_bolt Fluffy_Pillow 97112.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:14.084 build_a_shard K shadow_bolt Fluffy_Pillow 96697.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:15.665 default F call_dreadstalkers Fluffy_Pillow 96278.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), grimoire_felguard, archive_of_the_titans(20)
4:16.940 default H hand_of_guldan Fluffy_Pillow 97553.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, archive_of_the_titans(20)
4:18.216 build_a_shard K shadow_bolt Fluffy_Pillow 98829.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:19.906 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(2), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:21.596 default H hand_of_guldan Fluffy_Pillow 97695.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:22.864 build_a_shard K shadow_bolt Fluffy_Pillow 98963.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:24.553 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:26.244 build_a_shard K shadow_bolt Fluffy_Pillow 97695.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:27.931 default H hand_of_guldan Fluffy_Pillow 97382.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), archive_of_the_titans(20)
4:29.192 default I demonbolt Fluffy_Pillow 98643.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:30.452 build_a_shard K shadow_bolt Fluffy_Pillow 97903.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(2), archive_of_the_titans(20)
4:32.133 default I demonbolt Fluffy_Pillow 97584.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
4:33.386 default H hand_of_guldan Fluffy_Pillow 96837.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
4:34.639 default I demonbolt Fluffy_Pillow 98090.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
4:35.892 default F call_dreadstalkers Fluffy_Pillow 97343.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(20)
4:37.146 default H hand_of_guldan Fluffy_Pillow 98597.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:38.399 default I demonbolt Fluffy_Pillow 99850.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:39.653 build_a_shard K shadow_bolt Fluffy_Pillow 99104.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:41.324 default G summon_demonic_tyrant Fluffy_Pillow 98006.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:42.983 build_a_shard K shadow_bolt Fluffy_Pillow 97665.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), tyrant, quick_navigation(4), archive_of_the_titans(20)
4:44.642 build_a_shard K shadow_bolt Fluffy_Pillow 97324.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), tyrant, quick_navigation_final, archive_of_the_titans(20)
4:46.225 default E summon_vilefiend Fluffy_Pillow 96907.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), tyrant, quick_navigation_final, archive_of_the_titans(20)
4:47.808 default H hand_of_guldan Fluffy_Pillow 98490.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:48.997 default I demonbolt Fluffy_Pillow 99679.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:50.185 default H hand_of_guldan Fluffy_Pillow 98867.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:51.373 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
4:52.756 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
4:54.145 build_a_shard K shadow_bolt Fluffy_Pillow 97394.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
4:55.548 build_a_shard K shadow_bolt Fluffy_Pillow 96797.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(21), archive_of_the_titans(20)
4:57.053 default F call_dreadstalkers Fluffy_Pillow 96302.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(19), archive_of_the_titans(20)
4:58.195 default H hand_of_guldan Fluffy_Pillow 97444.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, overwhelming_power(18), archive_of_the_titans(20)
4:59.343 default I demonbolt Fluffy_Pillow 98592.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, overwhelming_power(25), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_GF_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=imp

DL_ID_Felguard : 17237 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17236.9 17236.9 15.4 / 0.089% 2176.0 / 12.6% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
970.5 961.1 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_ID_Felguard 17237
Demonbolt 1340 7.8% 47.2 5.79sec 8524 7497 Direct 48.0 7113 14234 8377 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.16 47.99 0.00 0.00 1.1370 0.0000 402002.26 402002.26 0.00 7496.96 7496.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.47 82.25% 7113.12 6520 8308 7115.00 6916 7339 280775 280775 0.00
crit 8.52 17.75% 14234.09 13040 16616 14236.05 0 16616 121227 121227 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1100 6.4% 62.9 4.72sec 5241 4747 Direct 62.8 4464 8927 5252 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.91 62.78 0.00 0.00 1.1042 0.0000 329755.94 329755.94 0.00 4746.94 4746.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.70 82.35% 4464.30 1634 5979 4458.27 4028 4821 230813 230813 0.00
crit 11.08 17.65% 8927.07 3267 11958 8914.85 4954 11438 98943 98943 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 140 (201) 0.8% (1.2%) 7.3 36.85sec 8256 0 Direct 7.3 4925 9849 5774 17.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 0.0000 0.0000 42083.39 42083.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.03 82.76% 4924.62 4925 4925 4922.65 0 4925 29706 29706 0.00
crit 1.26 17.24% 9849.24 9849 9849 7043.62 0 9849 12377 12377 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 36.85sec 2482 0 Direct 7.3 2111 4221 2482 17.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 0.0000 0.0000 18091.47 18091.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.40% 2110.55 2111 2111 2109.71 0 2111 12676 12676 0.00
crit 1.28 17.60% 4221.10 4221 4221 3086.24 0 4221 5416 5416 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1314 7.6% 93.8 3.14sec 4200 2814 Direct 93.2 3593 7186 4230 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.84 93.17 0.00 0.00 1.4924 0.0000 394099.86 394099.86 0.00 2814.03 2814.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.65 82.27% 3593.05 3335 4297 3593.61 3547 3650 275397 275397 0.00
crit 16.52 17.73% 7185.52 6670 8595 7186.50 6930 7619 118703 118703 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 288 1.7% 7.3 36.71sec 11859 0 Direct 7.2 10240 20481 12018 17.4%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.28 7.19 0.00 0.00 0.0000 0.0000 86348.28 86348.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.94 82.64% 10240.44 10240 10240 10236.34 0 10240 60808 60808 0.00
crit 1.25 17.36% 20480.88 20481 20481 14761.47 0 20481 25541 25541 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3163 / 3163
Felstorm 379 2.2% 10.4 30.14sec 10923 2906 Periodic 62.1 1556 3112 1831 17.7% 13.0%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.41 0.00 62.10 62.10 3.7595 0.6304 113746.66 162614.52 30.05 2905.55 2905.55
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.1 82.30% 1556.14 1454 1910 1556.10 1521 1595 79540 113712 30.05
crit 11.0 17.70% 3112.21 2908 3820 3112.51 2931 3439 34207 48902 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1061 6.2% 58.4 5.10sec 5444 5420 Direct 58.4 4626 9256 5444 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.40 58.40 0.00 0.00 1.0045 0.0000 317920.79 454505.95 30.05 5419.72 5419.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.08 82.33% 4626.02 4179 5592 4626.71 4524 4772 222420 317976 30.05
crit 10.32 17.67% 9256.43 8359 11183 9257.19 8506 10755 95501 136530 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1723 10.0% 173.6 1.71sec 2975 2006 Direct 173.6 2528 5054 2975 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.60 173.60 0.00 0.00 1.4832 0.0000 516404.46 738262.19 30.05 2005.52 2005.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 142.88 82.30% 2527.61 2284 3056 2528.00 2492 2574 361138 516290 30.05
crit 30.72 17.70% 5053.60 4569 6113 5054.73 4801 5366 155266 221972 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - urzul 1311 / 199
Many Faced Bite 493 0.4% 10.7 12.50sec 2088 2088 Direct 10.7 1777 3557 2088 17.4%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.68 10.68 0.00 0.00 1.0000 0.0000 22300.96 31881.90 30.05 2087.71 2087.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.82 82.57% 1777.38 1519 2032 1773.38 0 1993 15678 22413 29.99
crit 1.86 17.43% 3557.09 3037 4064 2798.46 0 4064 6623 9468 23.65
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 818 0.7% 47.5 2.74sec 775 649 Direct 47.5 660 1319 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.49 47.49 0.00 0.00 1.1945 0.0000 36824.20 52644.61 30.05 649.08 649.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.16 82.45% 659.64 562 753 658.80 569 742 25830 36927 30.05
crit 8.34 17.55% 1318.81 1125 1505 1300.10 0 1505 10994 15718 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - void_terror 1797 / 273
Double Breath 0 (149) 0.0% (0.9%) 0.0 0.00sec 0 7324

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7323.76 7323.76
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 489 0.4% 7.9 17.37sec 2790 0 Direct 7.9 2367 4737 2790 17.8%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.88 7.88 0.00 0.00 0.0000 0.0000 21988.58 21988.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.48 82.16% 2366.83 2026 2711 2360.08 0 2711 15327 15327 0.00
crit 1.41 17.84% 4736.62 4053 5422 3454.26 0 5422 6661 6661 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 488 0.4% 7.9 17.37sec 2787 0 Direct 7.9 2367 4735 2787 17.7%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.88 7.88 0.00 0.00 0.0000 0.0000 21968.63 21968.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.48 82.26% 2367.05 2026 2711 2359.83 0 2711 15347 15347 0.00
crit 1.40 17.74% 4734.57 4053 5422 3389.90 0 5422 6622 6622 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 820 0.7% 47.3 2.72sec 776 650 Direct 47.3 660 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.27 47.27 0.00 0.00 1.1938 0.0000 36705.19 52474.47 30.05 650.42 650.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.90 82.29% 659.75 562 753 658.89 0 753 25667 36694 30.04
crit 8.37 17.71% 1318.79 1125 1505 1302.30 0 1505 11039 15781 29.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3123 / 1560
Bile Spit 1096 3.2% 6.8 47.19sec 23938 0 Direct 6.8 8824 17649 10381 17.6%  
Periodic 33.4 2777 0 2777 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.44 33.44 0.0000 2.0000 163772.21 163772.21 0.00 2448.60 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.63 82.36% 8823.98 8474 10104 8824.13 8630 10104 49641 49641 0.00
crit 1.21 17.64% 17649.49 16947 20207 12942.38 0 20207 21271 21271 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.4 100.00% 2776.75 2502 3310 2777.10 2622 2867 92860 92860 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.1% 30.1 9.83sec 3654 3654 Direct 30.1 3100 6200 3654 17.9%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.10 30.10 0.00 0.00 1.0000 0.0000 109968.37 157213.00 30.05 3653.92 3653.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.72 82.13% 3099.83 2737 3621 3100.66 2960 3234 76620 109538 30.05
crit 5.38 17.87% 6199.91 5474 7243 6183.90 0 7243 33348 47675 29.96
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1293 3.7% 107.8 2.72sec 1795 1338 Direct 107.8 1526 3052 1795 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.81 107.81 0.00 0.00 1.3413 0.0000 193507.60 276642.36 30.05 1338.17 1338.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.78 82.35% 1525.61 1337 1775 1526.00 1459 1562 135446 193636 30.05
crit 19.03 17.65% 3051.51 2673 3550 3052.32 2795 3380 58062 83006 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3639 / 2401
Dreadbite 1335 5.1% 29.1 21.04sec 9078 0 Direct 29.1 7720 15428 9078 17.6%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.07 29.07 0.00 0.00 0.0000 0.0000 263898.33 263898.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.94 82.37% 7719.63 7139 9517 7719.86 7435 7979 184846 184846 0.00
crit 5.12 17.63% 15427.90 14278 19033 15346.70 0 19033 79053 79053 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 8.8% 311.9 1.90sec 1462 1106 Direct 311.9 1243 2484 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.85 311.85 0.00 0.00 1.3224 0.0000 456056.38 651987.36 30.05 1105.87 1105.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.68 82.31% 1242.74 1105 1473 1242.92 1228 1264 318990 456035 30.05
crit 55.17 17.69% 2484.34 2211 2947 2484.71 2368 2616 137066 195952 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 3115 / 3045
Fel Firebolt 3115 17.7% 1218.2 0.24sec 750 507 Direct 1213.2 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1218.17 1213.21 0.00 0.00 1.4774 0.0000 913116.73 913116.73 0.00 507.38 507.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 998.89 82.33% 639.66 569 761 639.74 631 652 638950 638950 0.00
crit 214.32 17.67% 1279.24 1138 1523 1279.40 1250 1319 274166 274166 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1701 / 258
melee 823 0.7% 47.7 2.72sec 776 651 Direct 47.7 660 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.65 47.65 0.00 0.00 1.1924 0.0000 36972.96 52857.28 30.05 650.71 650.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.27 82.42% 659.97 562 753 659.14 569 738 25919 37054 30.05
crit 8.38 17.58% 1319.50 1125 1505 1299.81 0 1505 11054 15804 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 412 0.4% 47.7 2.72sec 388 308 Direct 47.7 330 660 388 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.65 47.65 0.00 0.00 1.2617 0.0000 18487.44 26430.01 30.05 307.50 307.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.27 82.42% 329.95 281 376 329.51 282 371 12958 18525 30.05
crit 8.38 17.58% 660.03 562 753 651.26 0 753 5529 7905 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 467 0.4% 10.1 13.24sec 2095 2095 Direct 10.1 1780 3556 2095 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.09 10.09 0.00 0.00 1.0000 0.0000 21135.23 30215.35 30.05 2095.29 2095.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.30 82.26% 1780.16 1519 2032 1777.95 0 2008 14770 21116 30.01
crit 1.79 17.74% 3556.21 3037 4064 2768.29 0 4064 6365 9099 23.40
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - demonic_tyrant 4665 / 821
Demonfire 4665 4.8% 37.7 6.89sec 6526 4895 Direct 37.6 5562 11123 6540 17.6%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.65 37.58 0.00 0.00 1.3332 0.0000 245746.07 245746.07 0.00 4895.24 4895.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.97 82.41% 5561.52 5029 5917 5564.94 5447 5672 172220 172220 0.00
crit 6.61 17.59% 11123.29 10059 11834 11117.02 0 11834 73526 73526 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - bilescourge 3786 / 573
Toxic Bile 3786 3.3% 60.7 2.06sec 2803 2962 Direct 60.6 2383 4767 2804 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.67 60.64 0.00 0.00 0.9464 0.0000 170048.57 170048.57 0.00 2961.74 2961.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.94 82.34% 2383.25 2026 2711 2375.87 0 2699 119009 119009 0.00
crit 10.71 17.66% 4766.74 4053 5422 4723.86 0 5422 51040 51040 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - illidari_satyr 1246 / 187
melee 408 0.4% 46.6 2.67sec 388 325 Direct 46.6 330 659 388 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.65 46.65 0.00 0.00 1.1945 0.0000 18113.86 25895.94 30.05 325.10 325.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.37 82.25% 329.80 281 376 329.31 0 370 12653 18089 30.04
crit 8.28 17.75% 659.46 562 753 651.26 0 753 5461 7807 29.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 204 0.2% 46.6 2.67sec 194 153 Direct 46.6 165 330 194 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.65 46.65 0.00 0.00 1.2641 0.0000 9050.67 12939.01 30.05 153.48 153.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.40 82.33% 164.90 141 188 164.70 142 184 6333 9054 30.05
crit 8.24 17.67% 329.71 281 376 325.68 0 376 2718 3885 29.71
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 633 0.5% 10.1 12.59sec 2797 2797 Direct 10.1 2376 4751 2797 17.7%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.09 10.09 0.00 0.00 1.0000 0.0000 28222.57 28222.57 0.00 2797.36 2797.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.30 82.25% 2375.70 2026 2711 2370.29 0 2711 19716 19716 0.00
crit 1.79 17.75% 4750.55 4053 5422 3745.11 0 5422 8507 8507 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - shivarra 1894 / 290
melee 814 0.7% 47.6 2.74sec 776 650 Direct 47.6 659 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.60 47.60 0.00 0.00 1.1941 0.0000 36933.25 52800.52 30.05 649.82 649.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.19 82.34% 659.38 562 753 658.80 565 747 25842 36945 30.05
crit 8.41 17.66% 1319.46 1125 1505 1302.08 0 1481 11091 15856 29.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 408 0.4% 47.6 2.74sec 388 307 Direct 47.6 330 660 388 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.60 47.60 0.00 0.00 1.2640 0.0000 18485.73 26427.57 30.05 307.26 307.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.13 82.21% 329.71 281 376 329.42 285 370 12902 18445 30.05
crit 8.47 17.79% 659.52 562 753 652.52 0 753 5584 7982 29.75
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (103) 0.0% (0.6%) 0.0 0.00sec 0 3936

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3936.25 3936.25
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 168 0.1% 7.8 17.83sec 984 0 Direct 7.8 835 1669 984 17.9%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.78 7.78 0.00 0.00 0.0000 0.0000 7658.98 10949.44 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.39 82.11% 835.39 717 959 833.00 0 944 5337 7629 29.96
crit 1.39 17.89% 1668.73 1434 1919 1174.73 0 1919 2322 3320 21.16
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 168 0.1% 7.8 17.83sec 985 0 Direct 7.8 835 1670 985 18.0%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.78 7.78 0.00 0.00 0.0000 0.0000 7666.04 10959.53 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.38 82.02% 835.21 717 959 830.33 0 959 5330 7619 29.87
crit 1.40 17.98% 1670.38 1434 1919 1196.44 0 1919 2336 3340 21.52
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 168 0.1% 7.8 17.83sec 982 0 Direct 7.8 835 1673 982 17.6%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.78 7.78 0.00 0.00 0.0000 0.0000 7642.59 10926.00 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 82.41% 834.94 717 959 831.93 0 944 5353 7653 29.95
crit 1.37 17.59% 1672.88 1434 1919 1179.22 0 1919 2290 3273 21.20
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 168 0.1% 7.8 17.83sec 984 0 Direct 7.8 835 1673 984 17.7%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.78 7.78 0.00 0.00 0.0000 0.0000 7652.48 10940.13 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.40 82.26% 834.89 717 959 832.16 0 959 5343 7639 29.95
crit 1.38 17.74% 1673.36 1434 1919 1187.10 0 1919 2309 3301 21.32
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - darkhound 1280 / 195
Fel Bite 464 0.4% 10.0 13.33sec 2095 2095 Direct 10.0 1779 3555 2095 17.8%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 10.00 0.00 0.00 1.0000 0.0000 20951.53 29952.72 30.05 2094.94 2094.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.22 82.19% 1778.55 1519 2032 1774.43 0 2000 14620 20901 29.99
crit 1.78 17.81% 3554.87 3037 4064 2757.40 0 4064 6331 9052 23.30
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 816 0.7% 47.2 2.76sec 776 650 Direct 47.2 660 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.24 47.24 0.00 0.00 1.1942 0.0000 36675.36 52431.83 30.05 650.11 650.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.87 82.29% 659.55 562 753 658.54 565 737 25640 36655 30.05
crit 8.37 17.71% 1318.89 1125 1505 1297.18 0 1505 11036 15777 29.60
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1031 / 157
Demon Fangs 639 0.6% 10.3 12.61sec 2792 2793 Direct 10.3 2373 4750 2793 17.6%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.34 10.34 0.00 0.00 1.0000 0.0000 28860.90 28860.90 0.00 2792.54 2792.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.51 82.36% 2373.25 2026 2711 2369.12 0 2685 20202 20202 0.00
crit 1.82 17.64% 4750.09 4053 5422 3730.99 0 5422 8659 8659 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 391 0.3% 90.3 1.40sec 195 318 Direct 90.3 165 331 195 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.33 90.33 0.00 0.00 0.6109 0.0000 17571.74 25120.91 30.05 318.47 318.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.32 82.28% 165.25 141 188 165.02 142 185 12282 17558 30.05
crit 16.01 17.72% 330.51 281 376 329.14 0 373 5290 7563 29.97
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 973 / 83
Eye of Gul'dan 973 0.5% 28.5 4.66sec 862 1128 Periodic 61.6 399 0 399 0.0% 60.3%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.53 0.00 61.56 61.56 0.7641 2.9400 24580.57 24580.57 0.00 121.21 1127.55
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.6 100.00% 399.27 182 484 396.77 0 430 24581 24581 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4529 / 403
melee 3022 1.5% 21.7 1.69sec 3670 3071 Direct 21.7 3123 6253 3671 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.71 21.71 0.00 0.00 1.1951 0.0000 79675.83 113906.16 30.05 3071.07 3071.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.91 82.50% 3122.84 2665 3566 3112.60 2696 3509 55928 79956 30.05
crit 3.80 17.50% 6252.53 5330 7131 6014.88 0 7131 23748 33950 28.96
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1506 0.8% 21.7 1.69sec 1834 1451 Direct 21.7 1562 3118 1834 17.4%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.71 21.71 0.00 0.00 1.2637 0.0000 39806.68 56908.42 30.05 1451.10 1451.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.92 82.55% 1562.24 1333 1783 1555.17 0 1755 27995 40023 30.02
crit 3.79 17.45% 3118.49 2665 3566 2961.07 0 3566 11811 16886 28.61
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DL_ID_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.94sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.04sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 0.00 0.00 0.00 1.2034 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2381 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.54sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5068 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 17.8 14.53sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.19sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5526 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.37% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.6 23.2sec 10.1sec 52.25% 83.77% 15.6(15.6) 0.1

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.25%

Trigger Attempt Success

  • trigger_pct:20.03%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.6 32.2 11.7sec 5.0sec 40.37% 100.00% 4.9(4.9) 0.4

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.52%
  • demonic_core_2:15.85%
  • demonic_core_3:5.46%
  • demonic_core_4:2.54%

Trigger Attempt Success

  • trigger_pct:23.63%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.7sec 10.1sec 65.98% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.60%
  • dreadstalkers_4:6.37%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 162.0sec 2.7sec 1.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.82% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.9sec 0.0sec 10.14% 17.97% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 67.0sec 36.9sec 43.86% 0.00% 2.9(40.4) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.43%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.67%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.76%
  • overwhelming_power_14:1.81%
  • overwhelming_power_15:1.86%
  • overwhelming_power_16:1.91%
  • overwhelming_power_17:1.97%
  • overwhelming_power_18:2.02%
  • overwhelming_power_19:2.07%
  • overwhelming_power_20:2.13%
  • overwhelming_power_21:2.20%
  • overwhelming_power_22:2.26%
  • overwhelming_power_23:2.33%
  • overwhelming_power_24:2.38%
  • overwhelming_power_25:1.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.4 182.9sec 14.5sec 19.52% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.71%
  • portal_summons_2:0.77%
  • portal_summons_3:1.24%
  • portal_summons_4:1.54%
  • portal_summons_5:1.85%
  • portal_summons_6:1.82%
  • portal_summons_7:3.96%
  • portal_summons_8:5.85%
  • portal_summons_9:0.78%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 176.3sec 112.5sec 1.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.3 52.4sec 10.4sec 67.49% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.57%
  • quick_navigation_2:17.20%
  • quick_navigation_3:16.63%
  • quick_navigation_4:16.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.4sec 52.4sec 17.44% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.6sec 79.8sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.98% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.98%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.3 133.3sec 0.0sec 97.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.41%
  • wild_imps_2:2.03%
  • wild_imps_3:10.35%
  • wild_imps_4:20.91%
  • wild_imps_5:8.09%
  • wild_imps_6:14.86%
  • wild_imps_7:18.56%
  • wild_imps_8:5.05%
  • wild_imps_9:3.56%
  • wild_imps_10:3.98%
  • wild_imps_11:4.16%
  • wild_imps_12:1.72%
  • wild_imps_13:1.22%
  • wild_imps_14:1.28%
  • wild_imps_15:0.36%
  • wild_imps_16:0.16%
  • wild_imps_17:0.07%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 13.9sec
one_shard_hog 8.9 21.7sec
two_shard_hog 4.2 48.2sec
three_shard_hog 49.8 5.7sec
portal_summon 15.4 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_ID_Felguard
call_dreadstalkers Soul Shard 14.6 16.9 1.2 1.2 0.0
demonbolt Mana 48.2 96320.6 2000.0 2042.3 4.2
hand_of_guldan Soul Shard 62.9 166.6 2.6 2.6 1979.0
shadow_bolt Mana 93.8 187685.4 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7163.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
felstorm Energy 10.4 624.8 60.0 60.0 182.1
legion_strike Energy 58.4 3503.9 60.0 60.0 90.7
pet - wild_imp
fel_firebolt Energy 1218.2 18648.9 15.3 15.3 49.0
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 48.16 96.16 (50.61%) 2.00 0.16 0.17%
shadow_bolt Soul Shard 93.84 93.84 (49.39%) 1.00 0.01 0.01%
mana_regen Mana 556.26 288341.38 (100.00%) 518.36 11131.26 3.72%
pet - felguard
energy_regen Energy 375.37 3988.62 (100.00%) 10.63 18.58 0.46%
pet - demonic_tyrant
energy_regen Energy 37.66 0.00 (0.00%) 0.00 759.97 100.00%
pet - bilescourge
energy_regen Energy 14.58 0.00 (0.00%) 0.00 202.50 100.00%
pet - bilescourge
energy_regen Energy 13.70 0.00 (0.00%) 0.00 190.41 100.00%
pet - bilescourge
energy_regen Energy 9.98 0.00 (0.00%) 0.00 139.25 100.00%
pet - bilescourge
energy_regen Energy 12.47 0.00 (0.00%) 0.00 172.58 100.00%
pet - bilescourge
energy_regen Energy 8.67 0.00 (0.00%) 0.00 120.95 100.00%
pet - bilescourge
energy_regen Energy 0.01 0.00 (0.00%) 0.00 0.06 100.00%
Resource RPS-Gain RPS-Loss
Mana 961.10 970.53
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97112.38 88567.00 100000.00
Soul Shard 2.59 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DL_ID_Felguard Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_ID_Felguard Damage Per Second
Count 4999
Mean 17236.89
Minimum 15287.23
Maximum 19407.55
Spread ( max - min ) 4120.33
Range [ ( max - min ) / 2 * 100% ] 11.95%
Standard Deviation 554.0853
5th Percentile 16423.33
95th Percentile 18210.69
( 95th Percentile - 5th Percentile ) 1787.36
Mean Distribution
Standard Deviation 7.8367
95.00% Confidence Intervall ( 17221.53 - 17252.25 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3970
0.1 Scale Factor Error with Delta=300 2621
0.05 Scale Factor Error with Delta=300 10484
0.01 Scale Factor Error with Delta=300 262082
Priority Target DPS
Sample Data DL_ID_Felguard Priority Target Damage Per Second
Count 4999
Mean 17236.89
Minimum 15287.23
Maximum 19407.55
Spread ( max - min ) 4120.33
Range [ ( max - min ) / 2 * 100% ] 11.95%
Standard Deviation 554.0853
5th Percentile 16423.33
95th Percentile 18210.69
( 95th Percentile - 5th Percentile ) 1787.36
Mean Distribution
Standard Deviation 7.8367
95.00% Confidence Intervall ( 17221.53 - 17252.25 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3970
0.1 Scale Factor Error with Delta=300 2621
0.05 Scale Factor Error with Delta=300 10484
0.01 Scale Factor Error with Delta=300 262082
DPS(e)
Sample Data DL_ID_Felguard Damage Per Second (Effective)
Count 4999
Mean 17236.89
Minimum 15287.23
Maximum 19407.55
Spread ( max - min ) 4120.33
Range [ ( max - min ) / 2 * 100% ] 11.95%
Damage
Sample Data DL_ID_Felguard Damage
Count 4999
Mean 1272381.20
Minimum 924894.67
Maximum 1638695.52
Spread ( max - min ) 713800.85
Range [ ( max - min ) / 2 * 100% ] 28.05%
DTPS
Sample Data DL_ID_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_ID_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_ID_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_ID_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_ID_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_ID_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_ID_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_ID_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.86 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.57 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.22 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 43.05 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.36 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.43 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.11 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.02 call_dreadstalkers
X 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.93 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJJJJEGHJGJJHGHGJHGHJJJGEJDJJGJJHGHJJGEJJGJJJGJJJJJGJHEGHJDGF8JJJGJJJEJGJHGHHGHGHHGHHGEHGHJGJJDHGHJJEGJJJGJJJJJYJWJJJYJJJVQQTQTNOR9ATQTQTQJQJJJGJJHJEGJHGJHGHGJHGHHJGEJDJJGJJHGHJJGEJJGJJJGJHGJJJEHGHJJDGJHGHJJEFGJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.275 nether_portal_active N summon_vilefiend Fluffy_Pillow 99275.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.585 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:03.885 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:04.861 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:06.162 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.139 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98982.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.439 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.439 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.439 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.535 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97100.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.357 build_a_shard J shadow_bolt Fluffy_Pillow 97922.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.451 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97016.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.271 build_a_shard J shadow_bolt Fluffy_Pillow 97836.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.365 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96930.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.161 build_a_shard J shadow_bolt Fluffy_Pillow 97726.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.220 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96785.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.016 build_a_shard J shadow_bolt Fluffy_Pillow 97581.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:17.076 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96641.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.847 build_a_shard J shadow_bolt Fluffy_Pillow 97412.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.873 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96438.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.759 build_a_shard J shadow_bolt Fluffy_Pillow 97324.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.941 build_a_shard J shadow_bolt Fluffy_Pillow 96506.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.085 build_a_shard J shadow_bolt Fluffy_Pillow 95650.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.231 build_a_shard J shadow_bolt Fluffy_Pillow 94796.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.376 default E call_dreadstalkers Fluffy_Pillow 93941.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.232 default G hand_of_guldan Fluffy_Pillow 94797.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.063 default H demonbolt Fluffy_Pillow 95628.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.895 build_a_shard J shadow_bolt Fluffy_Pillow 94460.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.999 default G hand_of_guldan Fluffy_Pillow 93564.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.830 build_a_shard J shadow_bolt Fluffy_Pillow 94395.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6)
0:30.123 build_a_shard J shadow_bolt Fluffy_Pillow 93688.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation(2), archive_of_the_titans(7)
0:31.415 default H demonbolt Fluffy_Pillow 92980.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(7)
0:32.386 default G hand_of_guldan Fluffy_Pillow 91951.0/100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(7)
0:33.355 default H demonbolt Fluffy_Pillow 92920.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(7)
0:34.325 default G hand_of_guldan Fluffy_Pillow 91890.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(7)
0:35.294 build_a_shard J shadow_bolt Fluffy_Pillow 92859.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(8)
0:36.586 default H demonbolt Fluffy_Pillow 92151.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation(2), archive_of_the_titans(8)
0:37.557 default G hand_of_guldan Fluffy_Pillow 91122.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation(2), archive_of_the_titans(8)
0:38.528 default H demonbolt Fluffy_Pillow 92093.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(7), quick_navigation(2), archive_of_the_titans(8)
0:39.497 build_a_shard J shadow_bolt Fluffy_Pillow 91062.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation(2), archive_of_the_titans(8)
0:40.790 build_a_shard J shadow_bolt Fluffy_Pillow 90355.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(10), quick_navigation(3), archive_of_the_titans(9)
0:42.075 build_a_shard J shadow_bolt Fluffy_Pillow 89640.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(9)
0:43.744 default G hand_of_guldan Fluffy_Pillow 89309.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(9)
0:44.996 default E call_dreadstalkers Fluffy_Pillow 90561.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(9)
0:46.249 build_a_shard J shadow_bolt Fluffy_Pillow 91814.0/100000: 92% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(10)
0:47.917 default D summon_vilefiend Fluffy_Pillow 91482.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(10)
0:49.585 build_a_shard J shadow_bolt Fluffy_Pillow 93150.0/100000: 93% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(10)
0:51.256 build_a_shard J shadow_bolt Fluffy_Pillow 92821.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(11)
0:52.926 default G hand_of_guldan Fluffy_Pillow 92491.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(11)
0:54.179 build_a_shard J shadow_bolt Fluffy_Pillow 93744.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(11)
0:55.848 build_a_shard J shadow_bolt Fluffy_Pillow 93413.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(12)
0:57.517 default H demonbolt Fluffy_Pillow 93082.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), archive_of_the_titans(12)
0:58.764 default G hand_of_guldan Fluffy_Pillow 92329.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), archive_of_the_titans(12)
1:00.011 default H demonbolt Fluffy_Pillow 93576.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:01.257 build_a_shard J shadow_bolt Fluffy_Pillow 92822.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:02.918 build_a_shard J shadow_bolt Fluffy_Pillow 92483.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation_final, archive_of_the_titans(13)
1:04.500 default G hand_of_guldan Fluffy_Pillow 92065.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(13)
1:05.687 default E call_dreadstalkers Fluffy_Pillow 93252.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(14)
1:06.876 build_a_shard J shadow_bolt Fluffy_Pillow 94441.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(14)
1:08.458 build_a_shard J shadow_bolt Fluffy_Pillow 94023.0/100000: 94% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(14)
1:10.041 default G hand_of_guldan Fluffy_Pillow 93606.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:11.227 build_a_shard J shadow_bolt Fluffy_Pillow 94792.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:12.808 build_a_shard J shadow_bolt Fluffy_Pillow 94373.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:14.391 build_a_shard J shadow_bolt Fluffy_Pillow 93956.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(15)
1:16.094 default G hand_of_guldan Fluffy_Pillow 93659.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(16)
1:17.362 build_a_shard J shadow_bolt Fluffy_Pillow 94927.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(16)
1:19.052 build_a_shard J shadow_bolt Fluffy_Pillow 94617.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(16)
1:20.741 build_a_shard J shadow_bolt Fluffy_Pillow 94306.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation, archive_of_the_titans(17)
1:22.431 build_a_shard J shadow_bolt Fluffy_Pillow 93996.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(17)
1:24.120 build_a_shard J shadow_bolt Fluffy_Pillow 93685.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(17)
1:25.810 default G hand_of_guldan Fluffy_Pillow 93375.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(18)
1:27.078 build_a_shard J shadow_bolt Fluffy_Pillow 94643.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(18)
1:28.769 default H demonbolt Fluffy_Pillow 94334.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(18)
1:30.040 default E call_dreadstalkers Fluffy_Pillow 93605.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(19)
1:31.310 default G hand_of_guldan Fluffy_Pillow 94875.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:32.580 default H demonbolt Fluffy_Pillow 96145.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:33.851 build_a_shard J shadow_bolt Fluffy_Pillow 95416.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:35.540 default D summon_vilefiend Fluffy_Pillow 95105.0/100000: 95% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:37.216 default G hand_of_guldan Fluffy_Pillow 96781.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:38.475 default F summon_demonic_tyrant Fluffy_Pillow 98040.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:40.155 default 8 potion Fluffy_Pillow 97720.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:40.155 build_a_shard J shadow_bolt Fluffy_Pillow 97720.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:41.834 build_a_shard J shadow_bolt Fluffy_Pillow 97399.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:43.503 build_a_shard J shadow_bolt Fluffy_Pillow 97068.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:45.172 default G hand_of_guldan Fluffy_Pillow 96737.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:46.424 build_a_shard J shadow_bolt Fluffy_Pillow 97989.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:47.873 build_a_shard J shadow_bolt Fluffy_Pillow 97438.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
1:49.330 build_a_shard J shadow_bolt Fluffy_Pillow 96895.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect
1:50.795 default E call_dreadstalkers Fluffy_Pillow 96360.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
1:51.900 build_a_shard J shadow_bolt Fluffy_Pillow 97465.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
1:53.379 default G hand_of_guldan Fluffy_Pillow 96944.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
1:54.455 build_a_shard J shadow_bolt Fluffy_Pillow 98020.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
1:55.895 default H demonbolt Fluffy_Pillow 97460.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
1:56.984 default G hand_of_guldan Fluffy_Pillow 96549.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(14), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
1:58.076 default H demonbolt Fluffy_Pillow 97641.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
1:59.181 default H demonbolt Fluffy_Pillow 96746.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
2:00.292 default G hand_of_guldan Fluffy_Pillow 95857.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect
2:01.409 default H demonbolt Fluffy_Pillow 96974.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(4), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect
2:02.532 default G hand_of_guldan Fluffy_Pillow 96097.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20), battle_potion_of_intellect
2:03.661 default H demonbolt Fluffy_Pillow 97226.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, supreme_commander, wild_imps(8), vilefiend, overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect
2:04.877 default H demonbolt Fluffy_Pillow 96442.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(8), vilefiend, overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect
2:06.100 default G hand_of_guldan Fluffy_Pillow 95665.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(10), vilefiend, overwhelming_power(5), archive_of_the_titans(20)
2:07.336 default H demonbolt Fluffy_Pillow 96901.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), quick_navigation, overwhelming_power(4), archive_of_the_titans(20)
2:08.574 default H demonbolt Fluffy_Pillow 96139.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
2:09.819 default G hand_of_guldan Fluffy_Pillow 95384.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(9), quick_navigation, overwhelming_power(2), archive_of_the_titans(20)
2:11.072 default E call_dreadstalkers Fluffy_Pillow 96637.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(20)
2:12.340 default H demonbolt Fluffy_Pillow 97905.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(8), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:13.609 default G hand_of_guldan Fluffy_Pillow 97174.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(8), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:14.876 default H demonbolt Fluffy_Pillow 98441.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:16.138 build_a_shard J shadow_bolt Fluffy_Pillow 97703.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(8), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:17.819 default G hand_of_guldan Fluffy_Pillow 97384.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:19.079 build_a_shard J shadow_bolt Fluffy_Pillow 98644.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:20.758 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:22.437 default D summon_vilefiend Fluffy_Pillow 97683.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:24.117 default H demonbolt Fluffy_Pillow 99363.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:25.376 default G hand_of_guldan Fluffy_Pillow 98622.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:26.637 default H demonbolt Fluffy_Pillow 99883.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:27.898 build_a_shard J shadow_bolt Fluffy_Pillow 99144.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:29.578 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:31.257 default E call_dreadstalkers Fluffy_Pillow 97684.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:32.516 default G hand_of_guldan Fluffy_Pillow 98943.0/100000: 99% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:33.776 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:35.457 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:37.138 build_a_shard J shadow_bolt Fluffy_Pillow 97687.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:38.817 default G hand_of_guldan Fluffy_Pillow 97366.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:40.069 build_a_shard J shadow_bolt Fluffy_Pillow 98618.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:41.737 build_a_shard J shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:43.406 build_a_shard J shadow_bolt Fluffy_Pillow 97672.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
2:45.076 build_a_shard J shadow_bolt Fluffy_Pillow 97342.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:46.746 build_a_shard J shadow_bolt Fluffy_Pillow 97012.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:48.414 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96680.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(20)
2:49.666 build_a_shard J shadow_bolt Fluffy_Pillow 97932.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:51.338 nether_portal_building W call_dreadstalkers Fluffy_Pillow 97604.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:52.589 build_a_shard J shadow_bolt Fluffy_Pillow 98855.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:54.259 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:55.929 build_a_shard J shadow_bolt Fluffy_Pillow 97675.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:57.598 nether_portal_building Y hand_of_guldan Fluffy_Pillow 97344.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:58.851 build_a_shard J shadow_bolt Fluffy_Pillow 98597.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:00.511 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:02.172 build_a_shard J shadow_bolt Fluffy_Pillow 97666.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
3:03.554 nether_portal_building V nether_portal Fluffy_Pillow 97048.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
3:04.597 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98091.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(4), portal_summons, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
3:05.646 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99140.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(4), portal_summons(2), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
3:06.700 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
3:07.760 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99060.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(6), portal_summons(3), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
3:08.825 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), portal_summons(4), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
3:09.894 nether_portal_active N summon_vilefiend Fluffy_Pillow 99069.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(5), portal_summons(4), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
3:11.328 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(7), vilefiend, portal_summons(5), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)
3:12.425 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, portal_summons(6), overwhelming_power(15), archive_of_the_titans(20)
3:13.981 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(14), archive_of_the_titans(20)
3:13.981 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse
3:13.981 nether_portal_active T demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse
3:14.971 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96995.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse
3:15.968 nether_portal_active T demonbolt Fluffy_Pillow 97992.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse
3:16.963 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96987.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse
3:17.965 nether_portal_active T demonbolt Fluffy_Pillow 97989.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse
3:18.966 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96990.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.942 build_a_shard J shadow_bolt Fluffy_Pillow 97966.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.250 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97274.0/100000: 97% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.241 build_a_shard J shadow_bolt Fluffy_Pillow 98265.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.525 build_a_shard J shadow_bolt Fluffy_Pillow 97549.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.809 build_a_shard J shadow_bolt Fluffy_Pillow 96833.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.293 default G hand_of_guldan Fluffy_Pillow 96317.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power, archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.386 build_a_shard J shadow_bolt Fluffy_Pillow 97410.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.850 build_a_shard J shadow_bolt Fluffy_Pillow 96874.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(13), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.094 default H demonbolt Fluffy_Pillow 96118.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(15), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.013 build_a_shard J shadow_bolt Fluffy_Pillow 95037.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(15), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.240 default E call_dreadstalkers Fluffy_Pillow 94264.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.167 default G hand_of_guldan Fluffy_Pillow 95191.0/100000: 95% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.098 build_a_shard J shadow_bolt Fluffy_Pillow 96122.0/100000: 96% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
3:35.524 default H demonbolt Fluffy_Pillow 95548.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(2), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
3:36.602 default G hand_of_guldan Fluffy_Pillow 94626.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
3:37.683 build_a_shard J shadow_bolt Fluffy_Pillow 95707.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)
3:39.132 default H demonbolt Fluffy_Pillow 95156.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(14), archive_of_the_titans(20)
3:40.300 default G hand_of_guldan Fluffy_Pillow 94324.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(13), archive_of_the_titans(20)
3:41.474 default H demonbolt Fluffy_Pillow 95498.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation, overwhelming_power(12), archive_of_the_titans(20)
3:42.654 default G hand_of_guldan Fluffy_Pillow 94678.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation, overwhelming_power(11), archive_of_the_titans(20)
3:43.842 build_a_shard J shadow_bolt Fluffy_Pillow 95866.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(10), archive_of_the_titans(20)
3:45.433 default H demonbolt Fluffy_Pillow 95457.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(8), quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
3:46.643 default G hand_of_guldan Fluffy_Pillow 94667.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(8), quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
3:47.861 default H demonbolt Fluffy_Pillow 95885.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(6), archive_of_the_titans(20)
3:49.083 default H demonbolt Fluffy_Pillow 95107.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(8), quick_navigation, overwhelming_power(4), archive_of_the_titans(20)
3:50.321 build_a_shard J shadow_bolt Fluffy_Pillow 94345.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(10), quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
3:51.980 default G hand_of_guldan Fluffy_Pillow 94004.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(2), archive_of_the_titans(20)
3:53.234 default E call_dreadstalkers Fluffy_Pillow 95258.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:54.501 build_a_shard J shadow_bolt Fluffy_Pillow 96525.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:56.190 default D summon_vilefiend Fluffy_Pillow 96214.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:58.003 build_a_shard J shadow_bolt Fluffy_Pillow 98027.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:59.683 build_a_shard J shadow_bolt Fluffy_Pillow 97707.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:01.351 default G hand_of_guldan Fluffy_Pillow 97375.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:02.594 build_a_shard J shadow_bolt Fluffy_Pillow 98618.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:04.255 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:05.915 default H demonbolt Fluffy_Pillow 97666.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:07.160 default G hand_of_guldan Fluffy_Pillow 96911.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:08.408 default H demonbolt Fluffy_Pillow 98159.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:09.654 build_a_shard J shadow_bolt Fluffy_Pillow 97405.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:11.313 build_a_shard J shadow_bolt Fluffy_Pillow 97064.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:12.895 default G hand_of_guldan Fluffy_Pillow 96646.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:14.081 default E call_dreadstalkers Fluffy_Pillow 97832.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
4:15.267 build_a_shard J shadow_bolt Fluffy_Pillow 99018.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:16.851 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:18.433 default G hand_of_guldan Fluffy_Pillow 97588.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:19.622 build_a_shard J shadow_bolt Fluffy_Pillow 98777.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:21.204 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:22.785 build_a_shard J shadow_bolt Fluffy_Pillow 97585.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
4:24.487 default G hand_of_guldan Fluffy_Pillow 97287.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:25.755 build_a_shard J shadow_bolt Fluffy_Pillow 98555.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:27.444 default H demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:28.712 default G hand_of_guldan Fluffy_Pillow 97272.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(7), quick_navigation, archive_of_the_titans(20)
4:29.981 build_a_shard J shadow_bolt Fluffy_Pillow 98541.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(4), quick_navigation, archive_of_the_titans(20)
4:31.671 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:33.360 build_a_shard J shadow_bolt Fluffy_Pillow 97694.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:35.049 default E call_dreadstalkers Fluffy_Pillow 97383.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:36.317 default H demonbolt Fluffy_Pillow 98651.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:37.585 default G hand_of_guldan Fluffy_Pillow 97919.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:38.853 default H demonbolt Fluffy_Pillow 99187.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:40.120 build_a_shard J shadow_bolt Fluffy_Pillow 98454.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:41.809 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:43.489 default D summon_vilefiend Fluffy_Pillow 97684.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:45.166 default G hand_of_guldan Fluffy_Pillow 99361.0/100000: 99% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:46.425 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:48.104 default H demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:49.365 default G hand_of_guldan Fluffy_Pillow 97265.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:50.624 default H demonbolt Fluffy_Pillow 98524.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:51.877 build_a_shard J shadow_bolt Fluffy_Pillow 97777.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:53.545 build_a_shard J shadow_bolt Fluffy_Pillow 97445.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:55.206 default E call_dreadstalkers Fluffy_Pillow 97106.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
4:56.289 default F summon_demonic_tyrant Fluffy_Pillow 98189.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
4:57.738 default G hand_of_guldan Fluffy_Pillow 97638.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
4:58.830 build_a_shard J shadow_bolt Fluffy_Pillow 98730.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_ID_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DL_ID_Imp : 17202 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17202.2 17202.2 15.4 / 0.090% 2171.4 / 12.6% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
970.7 961.3 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_ID_Imp 17202
Demonbolt 1335 7.8% 47.0 5.81sec 8516 7493 Direct 47.9 7115 14226 8369 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.03 47.85 0.00 0.00 1.1365 0.0000 400485.68 400485.68 0.00 7492.72 7492.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.42 82.37% 7115.14 6520 8308 7116.77 6932 7335 280460 280460 0.00
crit 8.44 17.63% 14226.36 13040 16616 14227.46 0 16616 120026 120026 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1099 6.4% 62.9 4.72sec 5238 4746 Direct 62.8 4463 8915 5250 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.90 62.76 0.00 0.00 1.1038 0.0000 329515.15 329515.15 0.00 4746.01 4746.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.67 82.33% 4463.22 1634 5979 4457.14 4058 4837 230617 230617 0.00
crit 11.09 17.67% 8914.93 3267 11958 8903.85 3392 10799 98898 98898 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 37.76sec 8296 0 Direct 7.3 4925 9849 5810 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 0.0000 0.0000 42354.30 42354.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.98 82.00% 4924.62 4925 4925 4922.65 0 4925 29435 29435 0.00
crit 1.31 18.00% 9849.24 9849 9849 7303.69 0 9849 12919 12919 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 37.76sec 2485 0 Direct 7.3 2111 4221 2485 17.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.29 0.00 0.00 0.0000 0.0000 18115.54 18115.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.99 82.24% 2110.55 2111 2111 2109.71 0 2111 12651 12651 0.00
crit 1.29 17.76% 4221.10 4221 4221 3114.95 0 4221 5464 5464 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1317 7.7% 94.0 3.13sec 4201 2816 Direct 93.3 3593 7186 4231 17.8%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.01 93.34 0.00 0.00 1.4920 0.0000 394941.68 394941.68 0.00 2815.82 2815.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.76 82.23% 3592.86 3335 4297 3593.44 3553 3655 275780 275780 0.00
crit 16.58 17.77% 7186.11 6670 8595 7187.14 6953 7599 119161 119161 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 292 1.7% 7.3 37.21sec 11910 0 Direct 7.2 10240 20481 12075 17.9%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 7.24 0.00 0.00 0.0000 0.0000 87438.08 87438.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.94 82.09% 10240.44 10240 10240 10238.39 0 10240 60873 60873 0.00
crit 1.30 17.91% 20480.88 20481 20481 15035.97 0 20481 26565 26565 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3138 / 3138
Firebolt 3138 18.3% 103.8 2.89sec 9055 6924 Direct 103.0 7760 15511 9127 17.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.83 103.01 0.00 0.00 1.3078 0.0000 940179.98 940179.98 0.00 6924.09 6924.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.83 82.36% 7759.94 7027 9401 7760.96 7615 7916 658313 658313 0.00
crit 18.17 17.64% 15510.69 14053 18802 15512.08 14560 16884 281867 281867 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - darkhound 1287 / 196
Fel Bite 466 0.4% 10.1 12.92sec 2095 2095 Direct 10.1 1780 3556 2095 17.7%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.06 10.06 0.00 0.00 1.0000 0.0000 21076.59 30131.52 30.05 2094.88 2094.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.28 82.28% 1779.93 1519 2032 1775.62 0 2032 14735 21065 29.96
crit 1.78 17.72% 3556.12 3037 4064 2791.51 0 4064 6342 9067 23.58
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 821 0.7% 47.6 2.66sec 776 651 Direct 47.6 660 1320 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.61 47.61 0.00 0.00 1.1926 0.0000 36950.49 52825.16 30.05 650.73 650.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.23 82.38% 659.79 562 753 659.01 0 749 25880 36999 30.04
crit 8.39 17.62% 1319.92 1125 1505 1300.23 0 1505 11070 15826 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - illidari_satyr 1247 / 192
melee 409 0.4% 47.8 2.78sec 388 325 Direct 47.8 330 660 388 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.83 47.83 0.00 0.00 1.1933 0.0000 18556.05 26528.10 30.05 325.10 325.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.41 82.40% 329.83 281 376 329.49 282 374 12999 18583 30.05
crit 8.42 17.60% 659.96 562 753 650.39 0 753 5557 7945 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 205 0.2% 47.8 2.78sec 194 154 Direct 47.8 165 330 194 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.83 47.83 0.00 0.00 1.2628 0.0000 9285.31 13274.46 30.05 153.73 153.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.36 82.29% 164.93 141 188 164.76 142 187 6492 9281 30.05
crit 8.47 17.71% 329.83 281 376 324.85 0 376 2793 3993 29.62
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 633 0.6% 10.3 13.16sec 2796 2796 Direct 10.3 2376 4751 2796 17.7%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.33 10.33 0.00 0.00 1.0000 0.0000 28892.60 28892.60 0.00 2795.88 2795.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.51 82.34% 2376.41 2026 2711 2373.18 0 2679 20223 20223 0.00
crit 1.82 17.66% 4750.99 4053 5422 3743.10 0 5422 8669 8669 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vilefiend 3125 / 1560
Bile Spit 1096 3.2% 6.8 47.18sec 23958 0 Direct 6.8 8825 17640 10388 17.7%  
Periodic 33.4 2778 0 2778 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.44 33.44 0.0000 2.0000 163803.20 163803.20 0.00 2449.36 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.62 82.26% 8824.87 8474 10104 8824.85 8630 9445 49565 49565 0.00
crit 1.21 17.74% 17639.73 16947 20207 13021.39 0 20207 21362 21362 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.4 100.00% 2777.57 2502 3310 2777.95 2622 2868 92876 92876 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.1% 30.1 9.82sec 3651 3651 Direct 30.1 3100 6200 3651 17.8%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.09 30.09 0.00 0.00 1.0000 0.0000 109873.11 157076.80 30.05 3651.00 3651.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.75 82.23% 3100.14 2737 3621 3100.90 2898 3233 76716 109675 30.05
crit 5.35 17.77% 6199.74 5474 7243 6180.42 0 7243 33157 47402 29.96
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1295 3.8% 107.8 2.71sec 1797 1340 Direct 107.8 1526 3051 1797 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.84 107.84 0.00 0.00 1.3408 0.0000 193748.15 276986.25 30.05 1339.93 1339.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.70 82.25% 1525.77 1337 1775 1526.12 1453 1565 135336 193479 30.05
crit 19.14 17.75% 3051.12 2673 3550 3051.65 2816 3303 58412 83508 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1042 / 159
Demon Fangs 646 0.6% 10.5 12.37sec 2790 2790 Direct 10.5 2373 4749 2790 17.5%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.51 10.51 0.00 0.00 1.0000 0.0000 29317.62 29317.62 0.00 2789.76 2789.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.67 82.47% 2373.41 2026 2711 2367.54 0 2711 20571 20571 0.00
crit 1.84 17.53% 4748.53 4053 5422 3771.32 0 5422 8746 8746 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 396 0.3% 91.9 1.38sec 194 319 Direct 91.9 165 330 194 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.92 91.92 0.00 0.00 0.6103 0.0000 17870.51 25548.04 30.05 318.57 318.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.70 82.36% 165.29 141 188 165.06 142 187 12512 17888 30.05
crit 16.21 17.64% 330.47 281 376 329.33 0 376 5358 7660 29.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - dreadstalker 3642 / 2399
Dreadbite 1339 5.1% 29.0 21.05sec 9103 0 Direct 29.0 7721 15437 9103 17.9%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.05 29.05 0.00 0.00 0.0000 0.0000 264395.75 264395.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.84 82.09% 7720.65 7139 9517 7721.21 7490 7974 184077 184077 0.00
crit 5.20 17.91% 15437.34 14278 19033 15373.87 0 19033 80319 80319 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2303 8.8% 311.3 1.90sec 1462 1106 Direct 311.3 1243 2485 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.33 311.33 0.00 0.00 1.3219 0.0000 455160.43 650706.49 30.05 1105.96 1105.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.35 82.34% 1242.56 1105 1473 1242.73 1228 1262 318525 455370 30.05
crit 54.98 17.66% 2484.98 2211 2947 2485.10 2366 2618 136636 195337 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - urzul 1313 / 198
Many Faced Bite 493 0.4% 10.6 12.29sec 2085 2085 Direct 10.6 1778 3554 2085 17.3%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.60 10.60 0.00 0.00 1.0000 0.0000 22112.88 31613.01 30.05 2085.33 2085.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.77 82.72% 1778.32 1519 2032 1772.26 0 1983 15599 22301 29.96
crit 1.83 17.28% 3554.19 3037 4064 2791.32 0 4064 6514 9312 23.58
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 820 0.7% 47.2 2.69sec 777 651 Direct 47.2 660 1320 777 17.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.15 47.15 0.00 0.00 1.1941 0.0000 36660.03 52409.92 30.05 651.11 651.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.74 82.15% 659.69 562 753 659.04 565 744 25554 36532 30.05
crit 8.42 17.85% 1319.55 1125 1505 1299.15 0 1505 11106 15878 29.62
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wild_imp 3114 / 3045
Fel Firebolt 3114 17.7% 1217.5 0.24sec 750 508 Direct 1212.6 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1217.54 1212.63 0.00 0.00 1.4770 0.0000 912936.53 912936.53 0.00 507.68 507.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 998.07 82.31% 639.69 569 761 639.77 631 652 638459 638459 0.00
crit 214.56 17.69% 1279.28 1138 1523 1279.43 1247 1314 274478 274478 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4666 / 821
Demonfire 4666 4.8% 37.6 6.89sec 6528 4898 Direct 37.6 5561 11121 6542 17.6%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.65 37.57 0.00 0.00 1.3329 0.0000 245754.51 245754.51 0.00 4897.65 4897.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.94 82.36% 5561.47 5029 5917 5564.82 5472 5676 172070 172070 0.00
crit 6.63 17.64% 11120.63 10059 11834 11122.95 0 11834 73685 73685 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1692 / 256
melee 819 0.7% 47.1 2.68sec 777 651 Direct 47.1 660 1319 777 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.08 47.08 0.00 0.00 1.1932 0.0000 36577.17 52291.45 30.05 651.12 651.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.72 82.24% 659.82 562 753 659.10 569 739 25549 36525 30.05
crit 8.36 17.76% 1319.31 1125 1505 1298.35 0 1505 11028 15767 29.61
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 409 0.4% 47.1 2.68sec 388 307 Direct 47.1 330 660 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.08 47.08 0.00 0.00 1.2628 0.0000 18273.45 26124.09 30.05 307.35 307.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.77 82.34% 329.91 281 376 329.46 0 370 12789 18284 30.04
crit 8.31 17.66% 659.65 562 753 648.49 0 753 5484 7840 29.57
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 464 0.4% 10.0 13.00sec 2095 2095 Direct 10.0 1780 3560 2095 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.96 9.96 0.00 0.00 1.0000 0.0000 20854.76 29814.38 30.05 2094.69 2094.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.20 82.33% 1780.07 1519 2032 1772.20 0 2032 14591 20860 29.91
crit 1.76 17.67% 3559.56 3037 4064 2733.02 0 4064 6264 8955 23.08
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1787 / 269
Double Breath 0 (147) 0.0% (0.8%) 0.0 0.00sec 0 7309

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7309.04 7309.04
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 485 0.4% 7.8 17.63sec 2781 0 Direct 7.8 2367 4734 2782 17.5%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 21749.67 21749.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.45 82.48% 2366.59 2026 2711 2358.89 0 2711 15263 15263 0.00
crit 1.37 17.52% 4734.11 4053 5422 3334.93 0 5422 6487 6487 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 486 0.4% 7.8 17.63sec 2788 0 Direct 7.8 2367 4731 2787 17.8%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 21797.57 21797.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.43 82.21% 2366.90 2026 2711 2359.78 0 2711 15215 15215 0.00
crit 1.39 17.79% 4731.22 4053 5422 3366.07 0 5422 6582 6582 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 815 0.7% 46.8 2.78sec 777 651 Direct 46.8 660 1318 777 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.79 46.79 0.00 0.00 1.1943 0.0000 36350.45 51967.33 30.05 650.56 650.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.46 82.21% 659.75 562 753 658.90 568 753 25375 36277 30.05
crit 8.32 17.79% 1318.37 1125 1505 1300.61 0 1505 10975 15690 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - shivarra 1908 / 288
melee 823 0.7% 47.3 2.66sec 777 651 Direct 47.3 659 1319 777 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.27 47.27 0.00 0.00 1.1933 0.0000 36708.88 52479.76 30.05 650.73 650.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.89 82.26% 659.49 562 753 658.39 0 735 25646 36664 30.04
crit 8.39 17.74% 1319.35 1125 1505 1299.38 0 1505 11063 15816 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 410 0.4% 47.3 2.66sec 387 307 Direct 47.3 330 660 387 17.5%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.27 47.27 0.00 0.00 1.2627 0.0000 18311.27 26178.16 30.05 306.77 306.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.02 82.54% 329.74 281 376 329.26 0 371 12866 18394 30.04
crit 8.25 17.46% 659.70 562 753 648.83 0 753 5445 7784 29.57
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (103) 0.0% (0.6%) 0.0 0.00sec 0 3932

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3931.60 3931.60
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 168 0.1% 7.7 17.29sec 979 0 Direct 7.7 835 1674 979 17.1%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.73 7.73 0.00 0.00 0.0000 0.0000 7563.61 10813.08 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.40 82.87% 835.15 717 959 829.21 0 959 5347 7645 29.84
crit 1.32 17.13% 1674.08 1434 1919 1172.94 0 1919 2216 3169 21.05
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 169 0.1% 7.7 17.29sec 985 0 Direct 7.7 835 1672 985 17.8%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.73 7.73 0.00 0.00 0.0000 0.0000 7607.44 10875.76 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.35 82.16% 835.41 717 959 831.01 0 959 5303 7582 29.90
crit 1.38 17.84% 1671.52 1434 1919 1189.75 0 1919 2304 3294 21.40
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 169 0.1% 7.7 17.29sec 983 0 Direct 7.7 835 1673 983 17.6%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.73 7.73 0.00 0.00 0.0000 0.0000 7594.06 10856.61 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 82.38% 835.24 717 959 831.13 0 959 5317 7601 29.91
crit 1.36 17.62% 1673.07 1434 1919 1183.93 0 1919 2277 3256 21.26
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 169 0.1% 7.7 17.29sec 985 0 Direct 7.7 835 1671 985 17.9%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.73 7.73 0.00 0.00 0.0000 0.0000 7610.43 10880.03 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 82.11% 835.47 717 959 831.18 0 959 5300 7578 29.91
crit 1.38 17.89% 1670.99 1434 1919 1202.98 0 1919 2310 3302 21.64
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bilescourge 3791 / 574
Toxic Bile 3791 3.3% 60.7 2.12sec 2802 2959 Direct 60.6 2382 4765 2803 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.65 60.63 0.00 0.00 0.9467 0.0000 169923.93 169923.93 0.00 2959.16 2959.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.93 82.36% 2382.45 2026 2711 2377.90 0 2652 118957 118957 0.00
crit 10.70 17.64% 4764.52 4053 5422 4724.44 0 5422 50967 50967 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - eye_of_guldan 975 / 83
Eye of Gul'dan 975 0.5% 28.8 5.03sec 861 1129 Periodic 62.1 400 0 400 0.0% 60.9%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.84 0.00 62.09 62.09 0.7621 2.9409 24815.47 24815.47 0.00 121.30 1129.16
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.1 100.00% 399.68 182 484 397.87 0 433 24815 24815 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4500 / 388
melee 3003 1.5% 20.8 1.57sec 3688 3072 Direct 20.8 3122 6239 3688 18.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.79 20.79 0.00 0.00 1.2004 0.0000 76660.26 109595.04 30.05 3072.06 3072.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.02 81.86% 3122.27 2665 3566 3110.74 2678 3502 53132 75959 30.05
crit 3.77 18.14% 6238.72 5330 7131 6031.00 0 7131 23528 33636 29.08
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1497 0.7% 20.8 1.57sec 1838 1446 Direct 20.8 1561 3117 1838 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.79 20.79 0.00 0.00 1.2713 0.0000 38206.36 54620.57 30.05 1445.73 1445.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.09 82.23% 1561.34 1333 1783 1555.90 1349 1740 26690 38157 30.05
crit 3.69 17.77% 3117.38 2665 3566 2971.87 0 3566 11516 16464 28.74
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DL_ID_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.87sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.05sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 0.00 0.00 0.00 1.2043 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2377 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.50sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5076 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 17.8 14.68sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.18sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5519 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.8sec 186.8sec 6.76% 8.60% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.6 23.3sec 10.1sec 52.17% 83.47% 15.6(15.6) 0.1

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.17%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.4 32.1 11.7sec 5.0sec 40.34% 100.00% 4.7(4.7) 0.4

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.50%
  • demonic_core_2:15.97%
  • demonic_core_3:5.43%
  • demonic_core_4:2.44%

Trigger Attempt Success

  • trigger_pct:23.60%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.7sec 10.2sec 65.88% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.56%
  • dreadstalkers_4:6.32%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 158.8sec 2.4sec 1.39% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.82% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.9sec 0.0sec 10.14% 17.96% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 67.3sec 36.5sec 44.14% 0.00% 3.0(41.8) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.15%
  • overwhelming_power_21:2.21%
  • overwhelming_power_22:2.28%
  • overwhelming_power_23:2.35%
  • overwhelming_power_24:2.41%
  • overwhelming_power_25:1.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.3 182.9sec 14.5sec 19.52% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.70%
  • portal_summons_2:0.77%
  • portal_summons_3:1.24%
  • portal_summons_4:1.54%
  • portal_summons_5:1.85%
  • portal_summons_6:1.83%
  • portal_summons_7:3.98%
  • portal_summons_8:5.84%
  • portal_summons_9:0.76%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 165.3sec 111.9sec 1.48% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.4sec 10.3sec 67.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.55%
  • quick_navigation_2:17.17%
  • quick_navigation_3:16.67%
  • quick_navigation_4:16.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.2sec 52.2sec 17.46% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.5sec 79.9sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.98% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.98%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.1 134.3sec 0.0sec 97.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.41%
  • wild_imps_2:2.04%
  • wild_imps_3:10.36%
  • wild_imps_4:20.96%
  • wild_imps_5:8.11%
  • wild_imps_6:14.82%
  • wild_imps_7:18.58%
  • wild_imps_8:5.05%
  • wild_imps_9:3.55%
  • wild_imps_10:3.94%
  • wild_imps_11:4.15%
  • wild_imps_12:1.72%
  • wild_imps_13:1.22%
  • wild_imps_14:1.27%
  • wild_imps_15:0.36%
  • wild_imps_16:0.15%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 14.0sec
one_shard_hog 9.0 21.8sec
two_shard_hog 4.2 49.1sec
three_shard_hog 49.7 5.6sec
portal_summon 15.3 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_ID_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 48.0 96052.0 2000.0 2042.4 4.2
hand_of_guldan Soul Shard 62.9 166.5 2.6 2.6 1978.7
shadow_bolt Mana 94.0 188019.2 2000.0 2000.1 2.1
summon_demonic_tyrant Mana 3.6 7161.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.8 4153.2 40.0 40.0 226.4
pet - wild_imp
fel_firebolt Energy 1217.5 18638.2 15.3 15.3 49.0
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 48.03 95.91 (50.50%) 2.00 0.14 0.15%
shadow_bolt Soul Shard 94.01 94.00 (49.50%) 1.00 0.00 0.01%
mana_regen Mana 557.23 288395.13 (100.00%) 517.55 11071.54 3.70%
pet - imp
energy_regen Energy 425.69 3982.05 (100.00%) 9.35 22.74 0.57%
pet - demonic_tyrant
energy_regen Energy 37.65 0.00 (0.00%) 0.00 759.92 100.00%
pet - bilescourge
energy_regen Energy 9.97 0.00 (0.00%) 0.00 138.13 100.00%
pet - bilescourge
energy_regen Energy 14.22 0.00 (0.00%) 0.00 198.01 100.00%
pet - bilescourge
energy_regen Energy 10.40 0.00 (0.00%) 0.00 143.97 100.00%
pet - bilescourge
energy_regen Energy 10.60 0.00 (0.00%) 0.00 147.59 100.00%
pet - bilescourge
energy_regen Energy 8.62 0.00 (0.00%) 0.00 119.88 100.00%
pet - bilescourge
energy_regen Energy 5.21 0.00 (0.00%) 0.00 72.58 100.00%
Resource RPS-Gain RPS-Loss
Mana 961.28 970.74
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97134.69 89262.00 100000.00
Soul Shard 2.59 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DL_ID_Imp Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_ID_Imp Damage Per Second
Count 4999
Mean 17202.25
Minimum 15454.79
Maximum 19422.80
Spread ( max - min ) 3968.01
Range [ ( max - min ) / 2 * 100% ] 11.53%
Standard Deviation 555.5261
5th Percentile 16372.62
95th Percentile 18191.19
( 95th Percentile - 5th Percentile ) 1818.56
Mean Distribution
Standard Deviation 7.8571
95.00% Confidence Intervall ( 17186.85 - 17217.65 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4007
0.1 Scale Factor Error with Delta=300 2635
0.05 Scale Factor Error with Delta=300 10538
0.01 Scale Factor Error with Delta=300 263447
Priority Target DPS
Sample Data DL_ID_Imp Priority Target Damage Per Second
Count 4999
Mean 17202.25
Minimum 15454.79
Maximum 19422.80
Spread ( max - min ) 3968.01
Range [ ( max - min ) / 2 * 100% ] 11.53%
Standard Deviation 555.5261
5th Percentile 16372.62
95th Percentile 18191.19
( 95th Percentile - 5th Percentile ) 1818.56
Mean Distribution
Standard Deviation 7.8571
95.00% Confidence Intervall ( 17186.85 - 17217.65 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4007
0.1 Scale Factor Error with Delta=300 2635
0.05 Scale Factor Error with Delta=300 10538
0.01 Scale Factor Error with Delta=300 263447
DPS(e)
Sample Data DL_ID_Imp Damage Per Second (Effective)
Count 4999
Mean 17202.25
Minimum 15454.79
Maximum 19422.80
Spread ( max - min ) 3968.01
Range [ ( max - min ) / 2 * 100% ] 11.53%
Damage
Sample Data DL_ID_Imp Damage
Count 4999
Mean 1272850.42
Minimum 910695.59
Maximum 1691030.69
Spread ( max - min ) 780335.10
Range [ ( max - min ) / 2 * 100% ] 30.65%
DTPS
Sample Data DL_ID_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_ID_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_ID_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_ID_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_ID_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_ID_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_ID_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_ID_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.87 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.56 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.19 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 42.95 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.52 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.44 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.08 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.02 call_dreadstalkers
X 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.94 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJJJJEGHJGHJGJHGHJGHHGHJJEJGDJJGJJHGHJJGEJJGHJGJHGJJJJJGJEHGHJDHF8GJJGJJJEJGJHGHHGHGHHJGHEGHJGJHJDGHHJGEHGHHGJJJJYJJJYWJJJJVQQTQTQTNJOQR9ATQTHGJJGJJJJJEGHGJHGHHGHGHJJJEJDGHGJJJGHHJGJEJGJJJGJJJGJJJHGEHGHJDJFGJJJJJE

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.277 nether_portal_active N summon_vilefiend Fluffy_Pillow 99277.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.587 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:03.897 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:04.879 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans, battle_potion_of_intellect
0:06.187 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:07.171 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98988.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect
0:08.480 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect
0:08.480 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.480 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.581 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97106.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.407 build_a_shard J shadow_bolt Fluffy_Pillow 97932.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.510 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97035.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.337 build_a_shard J shadow_bolt Fluffy_Pillow 97862.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.439 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96964.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.239 build_a_shard J shadow_bolt Fluffy_Pillow 97764.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.305 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96830.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.106 build_a_shard J shadow_bolt Fluffy_Pillow 97631.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:17.171 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96696.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.947 build_a_shard J shadow_bolt Fluffy_Pillow 97472.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(25), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.852 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96377.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(24), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.637 build_a_shard J shadow_bolt Fluffy_Pillow 97162.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(23), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.681 build_a_shard J shadow_bolt Fluffy_Pillow 96206.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(22), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.704 build_a_shard J shadow_bolt Fluffy_Pillow 95229.0/100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(21), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.732 build_a_shard J shadow_bolt Fluffy_Pillow 94257.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(20), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.766 default E call_dreadstalkers Fluffy_Pillow 93291.0/100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation, overwhelming_power(19), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.671 default G hand_of_guldan Fluffy_Pillow 94196.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation, overwhelming_power(18), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.434 default H demonbolt Fluffy_Pillow 94959.0/100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation, overwhelming_power(17), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.200 build_a_shard J shadow_bolt Fluffy_Pillow 93725.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation, overwhelming_power(16), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.228 default G hand_of_guldan Fluffy_Pillow 92753.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.997 default H demonbolt Fluffy_Pillow 93522.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.767 build_a_shard J shadow_bolt Fluffy_Pillow 92292.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(6)
0:29.958 default G hand_of_guldan Fluffy_Pillow 91483.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(13), archive_of_the_titans(6)
0:30.858 build_a_shard J shadow_bolt Fluffy_Pillow 92383.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(12), archive_of_the_titans(7)
0:32.062 default H demonbolt Fluffy_Pillow 91587.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(10), archive_of_the_titans(7)
0:32.977 default G hand_of_guldan Fluffy_Pillow 90502.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(7)
0:33.889 default H demonbolt Fluffy_Pillow 91414.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(7)
0:34.808 build_a_shard J shadow_bolt Fluffy_Pillow 90333.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(7)
0:36.041 default G hand_of_guldan Fluffy_Pillow 89566.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation(2), overwhelming_power(6), archive_of_the_titans(8)
0:36.976 default H demonbolt Fluffy_Pillow 90501.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation(2), overwhelming_power(6), archive_of_the_titans(8)
0:37.911 default H demonbolt Fluffy_Pillow 89436.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation(2), overwhelming_power(5), archive_of_the_titans(8)
0:38.853 default G hand_of_guldan Fluffy_Pillow 88378.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(8)
0:39.800 default H demonbolt Fluffy_Pillow 89325.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(3), archive_of_the_titans(8)
0:40.754 build_a_shard J shadow_bolt Fluffy_Pillow 88279.0/100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(9)
0:42.031 build_a_shard J shadow_bolt Fluffy_Pillow 87556.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(8), quick_navigation(2), archive_of_the_titans(9)
0:43.710 default E call_dreadstalkers Fluffy_Pillow 87235.0/100000: 87% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), archive_of_the_titans(9)
0:45.154 build_a_shard J shadow_bolt Fluffy_Pillow 88679.0/100000: 89% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(10)
0:46.833 default G hand_of_guldan Fluffy_Pillow 88358.0/100000: 88% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(10)
0:48.086 default D summon_vilefiend Fluffy_Pillow 89611.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(10)
0:49.756 build_a_shard J shadow_bolt Fluffy_Pillow 91281.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(10)
0:51.426 build_a_shard J shadow_bolt Fluffy_Pillow 90951.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(11)
0:53.096 default G hand_of_guldan Fluffy_Pillow 90621.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(25), archive_of_the_titans(11)
0:54.184 build_a_shard J shadow_bolt Fluffy_Pillow 91709.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(11)
0:55.625 build_a_shard J shadow_bolt Fluffy_Pillow 91150.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(12)
0:57.073 default H demonbolt Fluffy_Pillow 90598.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), overwhelming_power(22), archive_of_the_titans(12)
0:58.170 default G hand_of_guldan Fluffy_Pillow 89695.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), overwhelming_power(21), archive_of_the_titans(12)
0:59.273 default H demonbolt Fluffy_Pillow 90798.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(12)
1:00.382 build_a_shard J shadow_bolt Fluffy_Pillow 89907.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), overwhelming_power(19), archive_of_the_titans(13)
1:01.870 build_a_shard J shadow_bolt Fluffy_Pillow 89395.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), overwhelming_power(18), archive_of_the_titans(13)
1:03.365 default G hand_of_guldan Fluffy_Pillow 88890.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), overwhelming_power(16), archive_of_the_titans(13)
1:04.500 default E call_dreadstalkers Fluffy_Pillow 90025.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), overwhelming_power(15), archive_of_the_titans(13)
1:05.641 build_a_shard J shadow_bolt Fluffy_Pillow 91166.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(14)
1:07.170 build_a_shard J shadow_bolt Fluffy_Pillow 90695.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(14)
1:08.650 default G hand_of_guldan Fluffy_Pillow 90175.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(14)
1:09.767 default H demonbolt Fluffy_Pillow 91292.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(14)
1:10.890 build_a_shard J shadow_bolt Fluffy_Pillow 90415.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(15)
1:12.392 default G hand_of_guldan Fluffy_Pillow 89917.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(15)
1:13.532 build_a_shard J shadow_bolt Fluffy_Pillow 91057.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(15)
1:15.064 default H demonbolt Fluffy_Pillow 90589.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(16)
1:16.225 default G hand_of_guldan Fluffy_Pillow 89750.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(16)
1:17.393 build_a_shard J shadow_bolt Fluffy_Pillow 90918.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(7), quick_navigation, overwhelming_power(2), archive_of_the_titans(16)
1:19.061 build_a_shard J shadow_bolt Fluffy_Pillow 90586.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(8), quick_navigation, archive_of_the_titans(16)
1:20.751 build_a_shard J shadow_bolt Fluffy_Pillow 90276.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), quick_navigation, archive_of_the_titans(17)
1:22.439 build_a_shard J shadow_bolt Fluffy_Pillow 89964.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), quick_navigation, archive_of_the_titans(17)
1:24.127 build_a_shard J shadow_bolt Fluffy_Pillow 89652.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), quick_navigation, archive_of_the_titans(17)
1:25.816 default G hand_of_guldan Fluffy_Pillow 89341.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(4), quick_navigation, archive_of_the_titans(18)
1:27.084 build_a_shard J shadow_bolt Fluffy_Pillow 90609.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(3), quick_navigation, archive_of_the_titans(18)
1:28.774 default E call_dreadstalkers Fluffy_Pillow 90299.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), quick_navigation, archive_of_the_titans(18)
1:30.464 default H demonbolt Fluffy_Pillow 91989.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:31.732 default G hand_of_guldan Fluffy_Pillow 91257.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:33.000 default H demonbolt Fluffy_Pillow 92525.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:34.262 build_a_shard J shadow_bolt Fluffy_Pillow 91787.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:35.941 default D summon_vilefiend Fluffy_Pillow 91466.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
1:37.610 default H demonbolt Fluffy_Pillow 93135.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
1:38.864 default F summon_demonic_tyrant Fluffy_Pillow 92389.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
1:40.534 default 8 potion Fluffy_Pillow 92059.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
1:40.534 default G hand_of_guldan Fluffy_Pillow 92059.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:41.788 build_a_shard J shadow_bolt Fluffy_Pillow 93313.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:43.459 build_a_shard J shadow_bolt Fluffy_Pillow 92984.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:45.128 default G hand_of_guldan Fluffy_Pillow 92653.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:46.380 build_a_shard J shadow_bolt Fluffy_Pillow 93905.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:48.047 build_a_shard J shadow_bolt Fluffy_Pillow 93572.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:49.718 build_a_shard J shadow_bolt Fluffy_Pillow 93243.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:51.377 default E call_dreadstalkers Fluffy_Pillow 92902.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:52.623 build_a_shard J shadow_bolt Fluffy_Pillow 94148.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:54.281 default G hand_of_guldan Fluffy_Pillow 93806.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:55.528 build_a_shard J shadow_bolt Fluffy_Pillow 95053.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:57.187 default H demonbolt Fluffy_Pillow 94712.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(13), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:58.432 default G hand_of_guldan Fluffy_Pillow 93957.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:59.679 default H demonbolt Fluffy_Pillow 95204.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:00.925 default H demonbolt Fluffy_Pillow 94450.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:02.170 default G hand_of_guldan Fluffy_Pillow 93695.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:03.415 default H demonbolt Fluffy_Pillow 94940.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:04.602 default G hand_of_guldan Fluffy_Pillow 94127.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:05.791 default H demonbolt Fluffy_Pillow 95316.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:06.980 default H demonbolt Fluffy_Pillow 94505.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:08.167 build_a_shard J shadow_bolt Fluffy_Pillow 93692.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(9), quick_navigation_final, archive_of_the_titans(20)
2:09.750 default G hand_of_guldan Fluffy_Pillow 93275.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
2:10.938 default H demonbolt Fluffy_Pillow 94463.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
2:12.124 default E call_dreadstalkers Fluffy_Pillow 93649.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(8), quick_navigation_final, archive_of_the_titans(20)
2:13.312 default G hand_of_guldan Fluffy_Pillow 94837.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:14.499 default H demonbolt Fluffy_Pillow 96024.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
2:15.777 build_a_shard J shadow_bolt Fluffy_Pillow 95302.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
2:17.477 default G hand_of_guldan Fluffy_Pillow 95002.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
2:18.755 build_a_shard J shadow_bolt Fluffy_Pillow 96280.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
2:20.455 default H demonbolt Fluffy_Pillow 95980.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
2:21.731 build_a_shard J shadow_bolt Fluffy_Pillow 95256.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
2:23.430 default D summon_vilefiend Fluffy_Pillow 94955.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
2:25.131 default G hand_of_guldan Fluffy_Pillow 96656.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(4), vilefiend, archive_of_the_titans(20)
2:26.407 default H demonbolt Fluffy_Pillow 97932.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(20)
2:27.678 default H demonbolt Fluffy_Pillow 97203.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), vilefiend, quick_navigation, archive_of_the_titans(20)
2:28.947 build_a_shard J shadow_bolt Fluffy_Pillow 96472.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation, archive_of_the_titans(20)
2:30.636 default G hand_of_guldan Fluffy_Pillow 96161.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(20)
2:31.904 default E call_dreadstalkers Fluffy_Pillow 97429.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(20)
2:33.394 default H demonbolt Fluffy_Pillow 98919.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
2:34.662 default G hand_of_guldan Fluffy_Pillow 98187.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:35.923 default H demonbolt Fluffy_Pillow 99448.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:37.183 default H demonbolt Fluffy_Pillow 98708.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:38.443 default G hand_of_guldan Fluffy_Pillow 97968.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
2:39.542 build_a_shard J shadow_bolt Fluffy_Pillow 99067.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
2:41.014 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
2:42.502 build_a_shard J shadow_bolt Fluffy_Pillow 97493.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
2:43.999 build_a_shard J shadow_bolt Fluffy_Pillow 96990.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
2:45.502 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96493.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
2:46.643 build_a_shard J shadow_bolt Fluffy_Pillow 97634.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
2:48.175 build_a_shard J shadow_bolt Fluffy_Pillow 97166.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20)
2:49.722 build_a_shard J shadow_bolt Fluffy_Pillow 96713.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
2:51.277 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96268.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
2:52.451 nether_portal_building W call_dreadstalkers Fluffy_Pillow 97442.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20)
2:53.633 build_a_shard J shadow_bolt Fluffy_Pillow 98624.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
2:55.214 build_a_shard J shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(7), dreadstalkers(2), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20)
2:56.813 build_a_shard J shadow_bolt Fluffy_Pillow 97602.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
2:58.422 build_a_shard J shadow_bolt Fluffy_Pillow 97211.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(4), archive_of_the_titans(20)
3:00.053 nether_portal_building V nether_portal Fluffy_Pillow 96842.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(2), archive_of_the_titans(20)
3:01.291 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98080.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(3), nether_portal, wild_imps(4), dreadstalkers(2), portal_summons, quick_navigation(3), overwhelming_power, archive_of_the_titans(20)
3:02.535 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99324.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), nether_portal, wild_imps, dreadstalkers(2), portal_summons(2), quick_navigation(3), archive_of_the_titans(20)
3:03.787 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), nether_portal, wild_imps(2), dreadstalkers(2), portal_summons(3), quick_navigation(3), archive_of_the_titans(20)
3:05.040 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99253.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(4), nether_portal, wild_imps(5), portal_summons(3), quick_navigation(3), archive_of_the_titans(20)
3:06.293 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), nether_portal, wild_imps(6), portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:07.546 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99253.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), nether_portal, wild_imps(7), portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:08.799 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), nether_portal, wild_imps(7), eyes_of_guldan(4), portal_summons(5), quick_navigation(3), archive_of_the_titans(20)
3:10.052 nether_portal_active N summon_vilefiend Fluffy_Pillow 99253.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), nether_portal, wild_imps(8), eyes_of_guldan(4), portal_summons(5), quick_navigation(3), archive_of_the_titans(20)
3:11.795 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), nether_portal, wild_imps(9), vilefiend, eyes_of_guldan(4), portal_summons(6), quick_navigation(3), archive_of_the_titans(20)
3:13.465 nether_portal_active O call_dreadstalkers Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(6), vilefiend, eyes_of_guldan(4), portal_summons(6), quick_navigation(3), archive_of_the_titans(20)
3:14.718 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99258.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, eyes_of_guldan(4), portal_summons(7), quick_navigation(3), archive_of_the_titans(20)
3:15.971 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), vilefiend, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20)
3:17.631 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20)
3:17.631 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse
3:17.631 nether_portal_active T demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse
3:18.679 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97053.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse
3:19.728 nether_portal_active T demonbolt Fluffy_Pillow 98102.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse
3:20.777 default H demonbolt Fluffy_Pillow 97151.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse
3:21.825 default G hand_of_guldan Fluffy_Pillow 96199.0/100000: 96% mana | 4.0/5: 80% soul_shard berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.841 build_a_shard J shadow_bolt Fluffy_Pillow 97215.0/100000: 97% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:24.194 build_a_shard J shadow_bolt Fluffy_Pillow 96568.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(2)
3:25.486 default G hand_of_guldan Fluffy_Pillow 95860.0/100000: 96% mana | 3.0/5: 60% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(2)
3:26.456 build_a_shard J shadow_bolt Fluffy_Pillow 96830.0/100000: 97% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.713 build_a_shard J shadow_bolt Fluffy_Pillow 96087.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(3)
3:29.157 build_a_shard J shadow_bolt Fluffy_Pillow 95531.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(3)
3:30.601 build_a_shard J shadow_bolt Fluffy_Pillow 94975.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.003 build_a_shard J shadow_bolt Fluffy_Pillow 94377.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(4)
3:33.405 default E call_dreadstalkers Fluffy_Pillow 93779.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, eyes_of_guldan(4), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(4)
3:34.518 default G hand_of_guldan Fluffy_Pillow 94892.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, eyes_of_guldan(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.607 default H demonbolt Fluffy_Pillow 95981.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, eyes_of_guldan(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.695 default G hand_of_guldan Fluffy_Pillow 95069.0/100000: 95% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, eyes_of_guldan(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:37.786 build_a_shard J shadow_bolt Fluffy_Pillow 96160.0/100000: 96% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(14), dreadstalkers(4), vilefiend, eyes_of_guldan(4), archive_of_the_titans(20)
3:39.486 default H demonbolt Fluffy_Pillow 95860.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, quick_navigation, archive_of_the_titans(20)
3:40.755 default G hand_of_guldan Fluffy_Pillow 95129.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
3:42.021 default H demonbolt Fluffy_Pillow 96395.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:43.284 default H demonbolt Fluffy_Pillow 95658.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(8), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:44.545 default G hand_of_guldan Fluffy_Pillow 94919.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:45.795 default H demonbolt Fluffy_Pillow 96169.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
3:47.046 default G hand_of_guldan Fluffy_Pillow 95420.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation(3), archive_of_the_titans(20)
3:48.298 default H demonbolt Fluffy_Pillow 96672.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(20)
3:49.552 build_a_shard J shadow_bolt Fluffy_Pillow 95926.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(8), quick_navigation(3), archive_of_the_titans(20)
3:51.220 build_a_shard J shadow_bolt Fluffy_Pillow 95594.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(10), quick_navigation(3), archive_of_the_titans(20)
3:52.889 build_a_shard J shadow_bolt Fluffy_Pillow 95263.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(20)
3:54.560 default E call_dreadstalkers Fluffy_Pillow 94934.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(20)
3:55.813 build_a_shard J shadow_bolt Fluffy_Pillow 96187.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:57.484 default D summon_vilefiend Fluffy_Pillow 95858.0/100000: 96% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:59.153 default G hand_of_guldan Fluffy_Pillow 97527.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:00.405 default H demonbolt Fluffy_Pillow 98779.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps, dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:01.659 default G hand_of_guldan Fluffy_Pillow 98033.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:02.911 build_a_shard J shadow_bolt Fluffy_Pillow 99285.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:04.582 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:06.252 build_a_shard J shadow_bolt Fluffy_Pillow 97676.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:07.913 default G hand_of_guldan Fluffy_Pillow 97337.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(7), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:09.101 default H demonbolt Fluffy_Pillow 98525.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(6), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:10.288 default H demonbolt Fluffy_Pillow 97712.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:11.477 build_a_shard J shadow_bolt Fluffy_Pillow 96901.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:13.060 default G hand_of_guldan Fluffy_Pillow 96484.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:14.247 build_a_shard J shadow_bolt Fluffy_Pillow 97671.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
4:15.830 default E call_dreadstalkers Fluffy_Pillow 97254.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
4:17.019 build_a_shard J shadow_bolt Fluffy_Pillow 98443.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:18.603 default G hand_of_guldan Fluffy_Pillow 98006.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:19.880 build_a_shard J shadow_bolt Fluffy_Pillow 99283.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
4:21.578 build_a_shard J shadow_bolt Fluffy_Pillow 98002.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:23.279 build_a_shard J shadow_bolt Fluffy_Pillow 97703.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:24.969 default G hand_of_guldan Fluffy_Pillow 97393.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:26.066 build_a_shard J shadow_bolt Fluffy_Pillow 98490.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
4:27.546 build_a_shard J shadow_bolt Fluffy_Pillow 97970.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
4:29.034 build_a_shard J shadow_bolt Fluffy_Pillow 97458.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
4:30.538 default G hand_of_guldan Fluffy_Pillow 96962.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
4:31.674 build_a_shard J shadow_bolt Fluffy_Pillow 98098.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(18), archive_of_the_titans(20)
4:33.194 build_a_shard J shadow_bolt Fluffy_Pillow 97618.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(16), archive_of_the_titans(20)
4:34.731 build_a_shard J shadow_bolt Fluffy_Pillow 97155.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation, overwhelming_power(15), archive_of_the_titans(20)
4:36.276 default H demonbolt Fluffy_Pillow 96700.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(13), archive_of_the_titans(20)
4:37.452 default G hand_of_guldan Fluffy_Pillow 95876.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(12), archive_of_the_titans(20)
4:38.634 default E call_dreadstalkers Fluffy_Pillow 97058.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(11), archive_of_the_titans(20)
4:39.821 default H demonbolt Fluffy_Pillow 98245.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(10), archive_of_the_titans(20)
4:41.018 default G hand_of_guldan Fluffy_Pillow 97442.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
4:42.226 default H demonbolt Fluffy_Pillow 98650.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
4:43.442 build_a_shard J shadow_bolt Fluffy_Pillow 97866.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(6), archive_of_the_titans(20)
4:45.073 default D summon_vilefiend Fluffy_Pillow 97497.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(4), archive_of_the_titans(20)
4:46.723 build_a_shard J shadow_bolt Fluffy_Pillow 99147.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
4:48.382 default F summon_demonic_tyrant Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
4:50.053 default G hand_of_guldan Fluffy_Pillow 97675.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
4:51.314 build_a_shard J shadow_bolt Fluffy_Pillow 98936.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
4:52.992 build_a_shard J shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:54.663 build_a_shard J shadow_bolt Fluffy_Pillow 97674.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:56.333 build_a_shard J shadow_bolt Fluffy_Pillow 97344.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(25), archive_of_the_titans(20)
4:57.781 build_a_shard J shadow_bolt Fluffy_Pillow 96792.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(24), archive_of_the_titans(20)
4:59.237 default E call_dreadstalkers Fluffy_Pillow 96248.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_ID_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=imp

DStr_GF_Felguard : 17542 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17541.9 17541.9 16.0 / 0.091% 2230.4 / 12.7% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
940.4 932.2 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_GF_Felguard 17542
Demonbolt 1235 7.1% 43.5 6.28sec 8516 7476 Direct 44.4 7098 14205 8352 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.50 44.35 0.00 0.00 1.1390 0.0000 370464.99 370464.99 0.00 7476.14 7476.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.52 82.35% 7097.68 6520 8308 7098.71 6879 7300 259234 259234 0.00
crit 7.83 17.65% 14205.15 13040 16616 14203.22 0 16616 111231 111231 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1025 5.9% 59.3 4.97sec 5189 4715 Direct 59.1 4419 8828 5199 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.25 59.13 0.00 0.00 1.1004 0.0000 307441.57 307441.57 0.00 4715.14 4715.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.66 82.29% 4418.59 1634 5979 4412.00 3961 4790 215015 215015 0.00
crit 10.47 17.71% 8827.71 3267 11958 8817.12 5209 10887 92426 92426 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 37.13sec 8284 0 Direct 7.3 4925 9849 5802 17.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.31 0.00 0.00 0.0000 0.0000 42416.37 42416.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.17% 4924.62 4925 4925 4920.68 0 4925 29582 29582 0.00
crit 1.30 17.83% 9849.24 9849 9849 7234.73 0 9849 12834 12834 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.3% 7.3 37.13sec 2482 0 Direct 7.3 2111 4221 2481 17.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.31 0.00 0.00 0.0000 0.0000 18140.02 18140.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.03 82.42% 2110.55 2111 2111 2109.71 0 2111 12717 12717 0.00
crit 1.28 17.58% 4221.10 4221 4221 3001.81 0 4221 5424 5424 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1301 7.4% 93.0 3.14sec 4198 2812 Direct 92.3 3593 7182 4227 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.98 92.32 0.00 0.00 1.4929 0.0000 390293.78 390293.78 0.00 2811.91 2811.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.99 82.31% 3592.51 3335 4297 3593.12 3551 3640 272991 272991 0.00
crit 16.33 17.69% 7182.32 6670 8595 7183.64 6938 7721 117302 117302 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 289 1.7% 7.3 36.52sec 11888 0 Direct 7.2 10240 20481 12052 17.7%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.21 0.00 0.00 0.0000 0.0000 86874.74 86874.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.93 82.31% 10240.44 10240 10240 10236.34 0 10240 60752 60752 0.00
crit 1.28 17.69% 20480.88 20481 20481 14982.71 0 20481 26122 26122 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3736 / 3736
(demonic_strength_) Felstorm 793 4.5% 5.4 60.70sec 43757 11411 Periodic 32.4 6241 12482 7338 17.6% 6.9%

Stats details: demonic_strength_felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 0.00 32.37 32.37 3.8346 0.6430 237518.16 339560.73 30.05 11411.46 11411.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.7 82.42% 6240.85 5816 7641 6237.85 6010 6541 166506 238041 30.05
crit 5.7 17.58% 12482.21 11633 15282 12452.77 0 15282 71012 101520 29.99
 
 

Action details: demonic_strength_felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Felstorm 367 2.1% 10.2 30.59sec 10835 2859 Periodic 60.6 1546 3091 1818 17.6% 12.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.17 0.00 60.60 60.60 3.7905 0.6360 110179.61 157514.98 30.05 2858.62 2858.62
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.9 82.41% 1546.34 1428 1910 1546.37 1511 1590 77234 110415 30.05
crit 10.7 17.59% 3091.09 2856 3820 3090.88 2948 3419 32945 47099 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 972 5.5% 53.2 5.53sec 5472 5447 Direct 53.2 4648 9294 5472 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.21 53.21 0.00 0.00 1.0045 0.0000 291160.15 416248.40 30.05 5447.03 5447.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.78 82.28% 4648.25 4179 5592 4649.33 4521 4794 203516 290950 30.05
crit 9.43 17.72% 9293.82 8359 11183 9293.38 0 10612 87644 125298 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1603 9.2% 161.1 1.82sec 2983 2023 Direct 161.1 2534 5069 2983 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.10 161.10 0.00 0.00 1.4746 0.0000 480564.57 687024.76 30.05 2023.02 2023.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.55 82.28% 2533.73 2284 3056 2534.26 2493 2583 335838 480121 30.05
crit 28.55 17.72% 5069.03 4569 6113 5070.29 4746 5436 144727 206904 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - grimoire_felguard 4765 / 1029
Felstorm 652 0.8% 3.9 80.80sec 10645 3638 Periodic 19.4 1832 3663 2154 17.6% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 19.42 19.42 2.9259 0.5921 41829.74 59800.64 30.05 3638.32 3638.32
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.42% 1832.31 1715 2197 1833.15 1771 1992 29326 41925 30.05
crit 3.4 17.58% 3663.06 3430 4393 3596.19 0 4393 12504 17876 29.49
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1849 2.3% 18.4 13.86sec 6441 6441 Direct 18.4 5470 10949 6441 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.43 18.43 0.00 0.00 1.0000 0.0000 118694.91 169688.63 30.05 6441.01 6441.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.16 82.28% 5469.89 5020 6430 5472.41 5201 5914 82940 118573 30.05
crit 3.27 17.72% 10948.59 10040 12861 10650.40 0 12249 35755 51116 29.24
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2265 2.8% 40.9 6.33sec 3549 3004 Direct 40.9 3018 6032 3549 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.95 40.95 0.00 0.00 1.1813 0.0000 145319.47 207751.63 30.05 3004.33 3004.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.73 82.38% 3017.95 2744 3515 3019.06 2909 3219 101807 145545 30.05
crit 7.21 17.62% 6031.84 5488 7030 6029.14 0 6799 43513 62207 30.03
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - illidari_satyr 1266 / 169
melee 418 0.3% 42.1 2.74sec 390 333 Direct 42.1 332 664 390 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.09 42.09 0.00 0.00 1.1737 0.0000 16433.26 23493.32 30.05 332.63 332.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.66 82.34% 331.78 294 358 332.17 294 357 11499 16439 30.05
crit 7.44 17.66% 663.57 587 717 655.76 0 717 4934 7054 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 209 0.2% 42.1 2.74sec 195 157 Direct 42.1 166 332 195 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.09 42.09 0.00 0.00 1.2416 0.0000 8211.92 11739.93 30.05 157.12 157.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.69 82.41% 165.89 147 179 166.07 147 179 5754 8226 30.05
crit 7.41 17.59% 331.84 294 358 327.69 0 358 2458 3513 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 639 0.5% 9.0 13.21sec 2825 2826 Direct 9.0 2394 4786 2826 18.1%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 8.98 0.00 0.00 1.0000 0.0000 25381.65 25381.65 0.00 2825.52 2825.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.36 81.95% 2393.60 2116 2582 2393.55 0 2582 17620 17620 0.00
crit 1.62 18.05% 4785.94 4233 5163 3562.06 0 5163 7761 7761 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wrathguard 1730 / 231
melee 840 0.6% 42.4 2.70sec 781 667 Direct 42.4 664 1328 781 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.41 42.41 0.00 0.00 1.1714 0.0000 33123.93 47354.63 30.05 666.76 666.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.93 82.36% 663.82 587 717 664.78 587 714 23186 33147 30.05
crit 7.48 17.64% 1328.42 1175 1433 1310.78 0 1433 9938 14208 29.60
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 420 0.3% 42.4 2.70sec 390 315 Direct 42.4 332 664 390 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.41 42.41 0.00 0.00 1.2392 0.0000 16555.06 23667.44 30.05 315.02 315.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.94 82.40% 331.95 294 358 332.45 294 357 11600 16583 30.05
crit 7.46 17.60% 663.84 587 717 654.85 0 717 4955 7084 29.61
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 470 0.4% 8.8 13.35sec 2113 2113 Direct 8.8 1793 3590 2113 17.8%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.85 8.85 0.00 0.00 1.0000 0.0000 18691.69 26722.02 30.05 2112.77 2112.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.28 82.23% 1793.36 1586 1935 1792.36 0 1935 13047 18653 29.96
crit 1.57 17.77% 3589.66 3172 3870 2655.28 0 3870 5644 8069 22.20
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vilefiend 3191 / 1516
Bile Spit 1152 3.1% 6.7 47.37sec 24230 0 Direct 6.7 8908 17810 10476 17.6%  
Periodic 32.9 2820 0 2820 0.0% 22.0%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 6.72 32.94 32.94 0.0000 2.0000 163311.07 163311.07 0.00 2479.29 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.54 82.40% 8908.04 8505 10104 8909.28 8646 9801 49364 49364 0.00
crit 1.18 17.60% 17809.90 17011 20207 12944.19 0 20207 21077 21077 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.9 100.00% 2819.82 2502 3310 2820.77 2633 2886 92871 92871 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 735 2.0% 28.6 10.20sec 3656 3656 Direct 28.6 3108 6214 3657 17.7%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.65 28.65 0.00 0.00 1.0000 0.0000 104739.90 149738.26 30.05 3656.35 3656.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.58 82.33% 3107.52 2737 3621 3108.95 2959 3237 73290 104776 30.05
crit 5.06 17.67% 6213.72 5474 7243 6189.02 0 7243 31450 44962 29.91
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1305 3.5% 103.2 2.80sec 1800 1351 Direct 103.2 1529 3060 1800 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.21 103.21 0.00 0.00 1.3317 0.0000 185727.09 265519.19 30.05 1351.27 1351.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.99 82.34% 1529.21 1342 1775 1529.81 1472 1578 129963 185798 30.05
crit 18.22 17.66% 3060.32 2683 3550 3061.55 2814 3360 55764 79721 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - darkhound 1310 / 173
Fel Bite 470 0.4% 8.8 12.98sec 2108 2108 Direct 8.8 1794 3587 2108 17.5%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.79 8.79 0.00 0.00 1.0000 0.0000 18534.78 26497.70 30.05 2108.14 2108.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.25 82.46% 1793.63 1586 1935 1792.45 0 1935 13004 18591 29.97
crit 1.54 17.54% 3586.92 3172 3870 2665.12 0 3870 5530 7906 22.31
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 841 0.6% 42.1 2.61sec 781 667 Direct 42.1 664 1328 781 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.12 42.12 0.00 0.00 1.1705 0.0000 32883.67 47011.15 30.05 667.01 667.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.70 82.40% 663.76 587 717 664.63 587 715 23036 32932 30.05
crit 7.41 17.60% 1328.19 1175 1433 1313.32 0 1433 9848 14079 29.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3376 / 2226
Dreadbite 1067 4.0% 29.0 20.96sec 7273 0 Direct 29.0 6173 12352 7273 17.8%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.99 28.99 0.00 0.00 0.0000 0.0000 210854.94 210854.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.83 82.21% 6173.37 5732 7613 6173.71 5983 6370 147137 147137 0.00
crit 5.16 17.79% 12352.09 11464 15227 12317.74 0 15227 63718 63718 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2309 8.7% 312.0 1.89sec 1464 1106 Direct 312.0 1243 2487 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.01 312.01 0.00 0.00 1.3231 0.0000 456659.18 652849.14 30.05 1106.15 1106.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.78 82.30% 1243.45 1101 1473 1243.63 1226 1264 319289 456463 30.05
crit 55.23 17.70% 2487.07 2203 2947 2487.44 2381 2602 137370 196387 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - shivarra 1957 / 261
melee 846 0.6% 42.6 2.65sec 781 668 Direct 42.6 664 1328 781 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.62 42.62 0.00 0.00 1.1696 0.0000 33294.41 47598.35 30.05 667.95 667.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.09 82.33% 663.79 587 717 664.44 587 714 23293 33299 30.05
crit 7.53 17.67% 1328.30 1175 1433 1309.82 0 1433 10002 14299 29.60
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 423 0.3% 42.6 2.65sec 391 316 Direct 42.6 332 664 391 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.62 42.62 0.00 0.00 1.2368 0.0000 16664.20 23823.47 30.05 316.13 316.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.04 82.20% 331.92 294 358 332.26 294 357 11629 16625 30.05
crit 7.58 17.80% 663.86 587 717 656.11 0 717 5035 7198 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (92) 0.0% (0.5%) 0.0 0.00sec 0 3980

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3979.79 3979.79
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 172 0.1% 6.8 17.84sec 992 0 Direct 6.8 843 1687 992 17.7%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 0.0000 0.0000 6793.98 9712.81 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.64 82.34% 843.19 749 914 840.40 0 914 4754 6797 29.90
crit 1.21 17.66% 1686.85 1498 1827 1131.49 0 1827 2040 2916 20.13
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 172 0.1% 6.8 17.84sec 995 0 Direct 6.8 843 1686 995 18.0%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 0.0000 0.0000 6813.90 9741.29 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.61 81.99% 843.28 749 914 840.53 0 914 4734 6768 29.91
crit 1.23 18.01% 1686.08 1498 1827 1143.40 0 1827 2080 2973 20.37
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 172 0.1% 6.8 17.84sec 996 0 Direct 6.8 843 1685 996 18.1%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 0.0000 0.0000 6817.36 9746.24 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.61 81.91% 843.43 749 914 839.92 0 914 4731 6763 29.88
crit 1.24 18.09% 1684.68 1498 1827 1160.47 0 1827 2086 2983 20.69
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 172 0.1% 6.8 17.84sec 997 0 Direct 6.8 843 1687 997 18.2%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 0.0000 0.0000 6824.37 9756.26 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.60 81.82% 843.17 749 914 841.17 0 914 4724 6753 29.93
crit 1.25 18.18% 1687.09 1498 1827 1152.83 0 1827 2100 3003 20.53
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wild_imp 2555 / 2433
Fel Firebolt 2555 13.9% 977.4 0.30sec 747 502 Direct 973.4 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 977.43 973.38 0.00 0.00 1.4866 0.0000 729988.66 729988.66 0.00 502.40 502.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 801.20 82.31% 637.24 569 761 637.26 626 649 510559 510559 0.00
crit 172.18 17.69% 1274.45 1138 1523 1274.46 1236 1310 219429 219429 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4660 / 820
Demonfire 4660 4.7% 37.7 6.91sec 6521 4889 Direct 37.6 5562 11121 6535 17.5%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.65 37.57 0.00 0.00 1.3340 0.0000 245545.15 245545.15 0.00 4888.71 4888.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.99 82.49% 5561.81 5029 5917 5565.21 5456 5677 172384 172384 0.00
crit 6.58 17.51% 11120.87 10059 11834 11118.35 0 11834 73161 73161 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - vicious_hellhound 1069 / 146
Demon Fangs 658 0.5% 9.4 12.26sec 2813 2813 Direct 9.4 2392 4783 2813 17.6%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.44 9.44 0.00 0.00 1.0000 0.0000 26562.00 26562.00 0.00 2813.18 2813.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.78 82.38% 2391.60 2116 2582 2388.62 0 2582 18602 18602 0.00
crit 1.66 17.62% 4783.23 4233 5163 3675.59 0 5163 7960 7960 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 411 0.3% 84.1 1.32sec 196 327 Direct 84.1 166 333 196 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.14 84.14 0.00 0.00 0.5994 0.0000 16469.52 23545.16 30.05 326.58 326.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.24 82.29% 166.26 147 179 166.40 147 177 11511 16457 30.05
crit 14.90 17.71% 332.66 294 358 332.59 0 358 4958 7088 30.02
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - urzul 1346 / 181
Many Faced Bite 502 0.4% 9.4 12.16sec 2114 2114 Direct 9.4 1792 3580 2114 18.0%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.45 9.45 0.00 0.00 1.0000 0.0000 19963.71 28540.52 30.05 2113.68 2113.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.75 82.01% 1791.85 1586 1935 1791.42 0 1935 13881 19845 30.00
crit 1.70 17.99% 3580.47 3172 3870 2761.18 0 3870 6082 8696 23.17
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 844 0.6% 42.8 2.59sec 782 668 Direct 42.8 664 1328 782 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.77 42.77 0.00 0.00 1.1702 0.0000 33429.64 47791.69 30.05 668.02 668.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.17 82.24% 663.77 587 717 664.53 587 714 23346 33376 30.05
crit 7.59 17.76% 1327.81 1175 1433 1312.14 0 1433 10084 14416 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - void_terror 1828 / 247
Double Breath 0 (134) 0.0% (0.8%) 0.0 0.00sec 0 7403

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7403.40 7403.40
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 493 0.4% 7.1 17.91sec 2808 0 Direct 7.1 2384 4774 2808 17.7%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 7.06 0.00 0.00 0.0000 0.0000 19821.84 19821.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.81 82.28% 2384.23 2116 2582 2382.95 0 2582 13849 13849 0.00
crit 1.25 17.72% 4773.54 4233 5163 3209.13 0 5163 5973 5973 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 493 0.4% 7.1 17.91sec 2805 0 Direct 7.1 2384 4773 2805 17.6%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 7.06 0.00 0.00 0.0000 0.0000 19801.14 19801.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.82 82.40% 2384.35 2116 2582 2380.28 0 2582 13870 13870 0.00
crit 1.24 17.60% 4772.51 4233 5163 3223.76 0 5163 5931 5931 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 842 0.6% 43.0 2.74sec 781 666 Direct 43.0 664 1327 781 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.97 42.97 0.00 0.00 1.1722 0.0000 33555.88 47972.16 30.05 666.25 666.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.38 82.33% 663.70 587 717 664.62 587 714 23479 33566 30.05
crit 7.59 17.67% 1327.26 1175 1433 1309.85 0 1433 10077 14406 29.62
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - bilescourge 3932 / 526
Toxic Bile 3932 3.0% 55.0 2.02sec 2824 3048 Direct 55.0 2397 4796 2824 17.8%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.02 55.02 0.00 0.00 0.9265 0.0000 155355.83 155355.83 0.00 3047.69 3047.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.23 82.21% 2396.72 2116 2582 2398.25 2116 2572 108407 108407 0.00
crit 9.79 17.79% 4795.69 4233 5163 4759.36 0 5163 46949 46949 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - prince_malchezaar 4683 / 385
melee 3125 1.5% 20.6 1.77sec 3712 3174 Direct 20.6 3145 6280 3712 18.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.65 20.65 0.00 0.00 1.1697 0.0000 76632.14 109554.84 30.05 3173.57 3173.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.91 81.91% 3144.69 2784 3396 3150.43 2784 3385 53176 76021 30.05
crit 3.74 18.09% 6279.52 5567 6791 6042.72 0 6791 23456 33533 28.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1558 0.7% 20.6 1.77sec 1851 1494 Direct 20.6 1572 3146 1851 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.65 20.65 0.00 0.00 1.2385 0.0000 38207.14 54621.69 30.05 1494.33 1494.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.99 82.28% 1571.66 1392 1698 1574.55 1392 1693 26697 38166 30.05
crit 3.66 17.72% 3146.03 2784 3396 3028.12 0 3396 11510 16455 28.88
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 987 / 83
Eye of Gul'dan 987 0.5% 28.1 5.33sec 869 1146 Periodic 61.0 400 0 400 0.0% 59.8%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.12 0.00 61.05 61.05 0.7582 2.9384 24434.89 24434.89 0.00 121.74 1145.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.0 100.00% 400.25 182 461 399.35 381 405 24435 24435 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DStr_GF_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.59sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.5 20.96sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 0.00 0.00 0.00 1.2050 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
Demonic Strength 5.5 60.47sec

Stats details: demonic_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.2164 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demonic_strength

Static Values
  • id:267171
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
Spelldata
  • id:267171
  • name:Demonic Strength
  • school:shadow
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.76sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.1274 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 183.43sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0911 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.66sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 0.00 0.00 0.00 1.5100 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 15.2 13.87sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.7 47.37sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 0.00 0.00 0.00 1.5401 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.09sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.6sec 187.6sec 6.76% 8.40% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.6 14.8 23.5sec 10.5sec 51.05% 82.85% 14.8(14.8) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.05%

Trigger Attempt Success

  • trigger_pct:19.94%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 22.6 30.2 12.7sec 5.3sec 39.72% 100.00% 4.5(4.5) 0.4

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.98%
  • demonic_core_2:16.21%
  • demonic_core_3:5.27%
  • demonic_core_4:2.27%

Trigger Attempt Success

  • trigger_pct:26.01%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.7sec 93.7sec 17.62% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.5 17.6 26.8sec 10.1sec 65.95% 0.00% 0.0(0.0) 10.8

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.45%
  • dreadstalkers_4:6.50%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 183.2sec 2.3sec 1.29% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.30%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.8sec 120.8sec 19.70% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.9sec 171.9sec 14.84% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 183.5sec 183.5sec 10.14% 18.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 67.2sec 36.7sec 43.88% 0.00% 2.9(40.7) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.29%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.43%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.67%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.76%
  • overwhelming_power_14:1.81%
  • overwhelming_power_15:1.86%
  • overwhelming_power_16:1.91%
  • overwhelming_power_17:1.97%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.08%
  • overwhelming_power_20:2.14%
  • overwhelming_power_21:2.20%
  • overwhelming_power_22:2.26%
  • overwhelming_power_23:2.33%
  • overwhelming_power_24:2.39%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.2 183.5sec 13.9sec 19.56% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.92%
  • portal_summons_2:0.77%
  • portal_summons_3:1.24%
  • portal_summons_4:1.90%
  • portal_summons_5:1.43%
  • portal_summons_6:1.82%
  • portal_summons_7:4.24%
  • portal_summons_8:5.88%
  • portal_summons_9:0.36%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 183.7sec 120.3sec 1.10% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.4sec 10.4sec 67.43% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.60%
  • quick_navigation_2:17.16%
  • quick_navigation_3:16.58%
  • quick_navigation_4:16.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.3sec 52.3sec 17.45% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.6sec 79.9sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.7sec 93.7sec 17.62% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.62%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.7 0.0 47.4sec 47.4sec 47.62% 0.00% 0.0(0.0) 6.3

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.62%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.4 149.4 54.9sec 0.0sec 95.24% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.33%
  • wild_imps_2:2.80%
  • wild_imps_3:29.91%
  • wild_imps_4:7.73%
  • wild_imps_5:9.35%
  • wild_imps_6:24.62%
  • wild_imps_7:5.41%
  • wild_imps_8:3.71%
  • wild_imps_9:4.88%
  • wild_imps_10:1.53%
  • wild_imps_11:1.17%
  • wild_imps_12:1.17%
  • wild_imps_13:0.45%
  • wild_imps_14:0.14%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
felguard: Demonic Strength 5.5 0.0 60.5sec 60.5sec 10.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard_felguard
  • cooldown name:buff_demonic_strength
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_strength_1:10.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267171
  • name:Demonic Strength
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.8sec 120.8sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.2 13.9sec
one_shard_hog 9.2 21.9sec
two_shard_hog 3.7 17.5sec
three_shard_hog 46.4 6.0sec
portal_summon 15.2 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_GF_Felguard
call_dreadstalkers Soul Shard 14.5 17.0 1.2 1.2 0.0
demonbolt Mana 44.5 89005.4 2000.0 2045.9 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 59.3 155.6 2.6 2.6 1975.5
shadow_bolt Mana 93.0 185952.8 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7179.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.7 6.7 1.0 1.0 0.0
pet - felguard
demonic_strength_felstorm Energy 5.4 325.7 60.0 60.0 729.3
felstorm Energy 10.2 610.1 60.0 60.0 180.6
legion_strike Energy 53.2 3192.8 60.0 60.0 91.2
pet - grimoire_felguard
felstorm Energy 3.9 235.8 60.0 60.0 177.4
legion_strike Energy 18.4 1105.7 60.0 60.0 107.3
pet - wild_imp
fel_firebolt Energy 977.4 15188.8 15.5 15.5 48.1
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 44.50 88.98 (48.90%) 2.00 0.03 0.03%
shadow_bolt Soul Shard 92.98 92.98 (51.10%) 1.00 0.00 0.00%
mana_regen Mana 551.58 279655.81 (100.00%) 507.01 19810.28 6.62%
pet - felguard
energy_regen Energy 378.75 3988.28 (100.00%) 10.53 18.58 0.46%
pet - grimoire_felguard
energy_regen Energy 91.55 913.85 (100.00%) 9.98 48.35 5.03%
pet - demonic_tyrant
energy_regen Energy 37.65 0.00 (0.00%) 0.00 760.04 100.00%
pet - bilescourge
energy_regen Energy 7.12 0.00 (0.00%) 0.00 97.95 100.00%
pet - bilescourge
energy_regen Energy 14.34 0.00 (0.00%) 0.00 197.97 100.00%
pet - bilescourge
energy_regen Energy 14.30 0.00 (0.00%) 0.00 197.12 100.00%
pet - bilescourge
energy_regen Energy 9.40 0.00 (0.00%) 0.00 130.59 100.00%
pet - bilescourge
energy_regen Energy 5.57 0.00 (0.00%) 0.00 76.45 100.00%
pet - bilescourge
energy_regen Energy 1.18 0.00 (0.00%) 0.00 16.37 100.00%
Resource RPS-Gain RPS-Loss
Mana 932.16 940.44
Soul Shard 0.61 0.61
Combat End Resource Mean Min Max
Mana 97570.67 93704.00 100000.00
Soul Shard 2.52 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.1%

Statistics & Data Analysis

Fight Length
Sample Data DStr_GF_Felguard Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_GF_Felguard Damage Per Second
Count 4999
Mean 17541.93
Minimum 15577.52
Maximum 19739.64
Spread ( max - min ) 4162.12
Range [ ( max - min ) / 2 * 100% ] 11.86%
Standard Deviation 576.6519
5th Percentile 16673.54
95th Percentile 18544.04
( 95th Percentile - 5th Percentile ) 1870.49
Mean Distribution
Standard Deviation 8.1559
95.00% Confidence Intervall ( 17525.94 - 17557.92 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4152
0.1 Scale Factor Error with Delta=300 2839
0.05 Scale Factor Error with Delta=300 11355
0.01 Scale Factor Error with Delta=300 283865
Priority Target DPS
Sample Data DStr_GF_Felguard Priority Target Damage Per Second
Count 4999
Mean 17541.93
Minimum 15577.52
Maximum 19739.64
Spread ( max - min ) 4162.12
Range [ ( max - min ) / 2 * 100% ] 11.86%
Standard Deviation 576.6519
5th Percentile 16673.54
95th Percentile 18544.04
( 95th Percentile - 5th Percentile ) 1870.49
Mean Distribution
Standard Deviation 8.1559
95.00% Confidence Intervall ( 17525.94 - 17557.92 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4152
0.1 Scale Factor Error with Delta=300 2839
0.05 Scale Factor Error with Delta=300 11355
0.01 Scale Factor Error with Delta=300 283865
DPS(e)
Sample Data DStr_GF_Felguard Damage Per Second (Effective)
Count 4999
Mean 17541.93
Minimum 15577.52
Maximum 19739.64
Spread ( max - min ) 4162.12
Range [ ( max - min ) / 2 * 100% ] 11.86%
Damage
Sample Data DStr_GF_Felguard Damage
Count 4999
Mean 1215631.47
Minimum 859941.15
Maximum 1608084.84
Spread ( max - min ) 748143.69
Range [ ( max - min ) / 2 * 100% ] 30.77%
DTPS
Sample Data DStr_GF_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_GF_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_GF_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_GF_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_GF_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_GF_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_GF_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_GF_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
B 5.47 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
C 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
D 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
E 1.97 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
F 4.77 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
G 11.55 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
H 1.62 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
I 43.21 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
J 39.88 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
K 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
L 93.48 shadow_bolt
actions.nether_portal_active
# count action,conditions
P 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Q 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
R 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
S 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
T 13.91 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
U 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
V 0.03 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
W 3.62 demonbolt,if=buff.demonic_core.up
X 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
Y 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Z 1.01 call_dreadstalkers
a 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
b 1.79 hand_of_guldan,if=soul_shard>=5
c 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367BYPQRTU9ALTLTLTLTLTLTLLLLLIGJIJLILJIJLILJIJLJIGJLFJILJILBJIJLLGILLILLLILLLLLGIJIJLFH8LILLLLGILLJIJIBJEJIJJLIGJILLLILLJFIJLLGILLJILLLLbLLLZaLLLLbBLLLYTTWQRU9AWTWTLTLTLLLLLIGJILJIJJIJIJJLIJGLLFIBLELLJIJLLGILLIJLILJILJLLGIJIJLFHLIJLLLGI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 default B demonic_strength Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_building Y nether_portal Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.258 nether_portal_active P grimoire_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.240 nether_portal_active Q summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:04.550 nether_portal_active R call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:05.849 nether_portal_active T hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:06.827 nether_portal_active U summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.130 default 9 use_items Fluffy_Pillow 98007.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.130 default A berserking Fluffy_Pillow 98007.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.130 build_a_shard L shadow_bolt Fluffy_Pillow 98007.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.225 nether_portal_active T hand_of_guldan Fluffy_Pillow 97102.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.046 build_a_shard L shadow_bolt Fluffy_Pillow 97923.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.140 nether_portal_active T hand_of_guldan Fluffy_Pillow 97017.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.961 build_a_shard L shadow_bolt Fluffy_Pillow 97838.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.055 nether_portal_active T hand_of_guldan Fluffy_Pillow 96932.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.846 build_a_shard L shadow_bolt Fluffy_Pillow 97723.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.899 nether_portal_active T hand_of_guldan Fluffy_Pillow 96776.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.690 build_a_shard L shadow_bolt Fluffy_Pillow 97567.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.744 nether_portal_active T hand_of_guldan Fluffy_Pillow 96621.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.510 build_a_shard L shadow_bolt Fluffy_Pillow 97387.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.533 nether_portal_active T hand_of_guldan Fluffy_Pillow 96410.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.413 build_a_shard L shadow_bolt Fluffy_Pillow 97290.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.588 build_a_shard L shadow_bolt Fluffy_Pillow 96465.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.726 build_a_shard L shadow_bolt Fluffy_Pillow 95603.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.856 build_a_shard L shadow_bolt Fluffy_Pillow 94733.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.989 build_a_shard L shadow_bolt Fluffy_Pillow 93866.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.121 default I hand_of_guldan Fluffy_Pillow 92998.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:25.945 default G call_dreadstalkers Fluffy_Pillow 93822.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.769 default J demonbolt Fluffy_Pillow 94646.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.597 default I hand_of_guldan Fluffy_Pillow 93474.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.421 default J demonbolt Fluffy_Pillow 94298.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6)
0:29.384 build_a_shard L shadow_bolt Fluffy_Pillow 93261.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6)
0:30.669 default I hand_of_guldan Fluffy_Pillow 92546.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(7)
0:31.634 build_a_shard L shadow_bolt Fluffy_Pillow 93511.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(7)
0:32.919 default J demonbolt Fluffy_Pillow 92796.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:33.875 default I hand_of_guldan Fluffy_Pillow 91752.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:34.834 default J demonbolt Fluffy_Pillow 92711.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(7)
0:35.748 build_a_shard L shadow_bolt Fluffy_Pillow 91625.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(8)
0:36.967 default I hand_of_guldan Fluffy_Pillow 90844.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(8)
0:37.881 build_a_shard L shadow_bolt Fluffy_Pillow 91758.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(8)
0:39.099 default J demonbolt Fluffy_Pillow 90976.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), wild_imps(6), quick_navigation_final, archive_of_the_titans(8)
0:40.013 default I hand_of_guldan Fluffy_Pillow 89890.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:40.927 default J demonbolt Fluffy_Pillow 90804.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:41.840 build_a_shard L shadow_bolt Fluffy_Pillow 89717.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:43.423 default J demonbolt Fluffy_Pillow 89300.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:44.609 default I hand_of_guldan Fluffy_Pillow 88486.0/100000: 88% mana | 5.0/5: 100% soul_shard wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:45.796 default G call_dreadstalkers Fluffy_Pillow 89673.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(6), quick_navigation, archive_of_the_titans(10)
0:47.634 default J demonbolt Fluffy_Pillow 91511.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(10)
0:48.902 build_a_shard L shadow_bolt Fluffy_Pillow 90779.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(10)
0:50.591 default F summon_vilefiend Fluffy_Pillow 90468.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(11)
0:52.269 default J demonbolt Fluffy_Pillow 92146.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(11)
0:53.530 default I hand_of_guldan Fluffy_Pillow 91407.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(11)
0:54.791 build_a_shard L shadow_bolt Fluffy_Pillow 92668.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(11)
0:56.461 default J demonbolt Fluffy_Pillow 92338.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(12)
0:57.708 default I hand_of_guldan Fluffy_Pillow 91585.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(12)
0:58.953 build_a_shard L shadow_bolt Fluffy_Pillow 92830.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(12)
1:00.614 default B demonic_strength Fluffy_Pillow 92491.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:01.861 default J demonbolt Fluffy_Pillow 93738.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:03.105 default I hand_of_guldan Fluffy_Pillow 92982.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:04.350 default J demonbolt Fluffy_Pillow 94227.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:05.595 build_a_shard L shadow_bolt Fluffy_Pillow 93472.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), archive_of_the_titans(14)
1:07.254 build_a_shard L shadow_bolt Fluffy_Pillow 93131.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, archive_of_the_titans(14)
1:08.837 default G call_dreadstalkers Fluffy_Pillow 92714.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(14)
1:10.022 default I hand_of_guldan Fluffy_Pillow 93899.0/100000: 94% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:11.207 build_a_shard L shadow_bolt Fluffy_Pillow 95084.0/100000: 95% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:12.790 build_a_shard L shadow_bolt Fluffy_Pillow 94667.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:14.372 default I hand_of_guldan Fluffy_Pillow 94249.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:15.560 build_a_shard L shadow_bolt Fluffy_Pillow 95437.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:17.143 build_a_shard L shadow_bolt Fluffy_Pillow 95020.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:18.726 build_a_shard L shadow_bolt Fluffy_Pillow 94603.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(16)
1:20.426 default I hand_of_guldan Fluffy_Pillow 94303.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), archive_of_the_titans(17)
1:21.703 build_a_shard L shadow_bolt Fluffy_Pillow 95580.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(17)
1:23.403 build_a_shard L shadow_bolt Fluffy_Pillow 95280.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), archive_of_the_titans(17)
1:25.102 build_a_shard L shadow_bolt Fluffy_Pillow 94979.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(18)
1:26.803 build_a_shard L shadow_bolt Fluffy_Pillow 94680.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(18)
1:28.505 build_a_shard L shadow_bolt Fluffy_Pillow 94382.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(18)
1:30.204 default G call_dreadstalkers Fluffy_Pillow 94081.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(19)
1:31.472 default I hand_of_guldan Fluffy_Pillow 95349.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(2), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:32.740 default J demonbolt Fluffy_Pillow 96617.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:34.008 default I hand_of_guldan Fluffy_Pillow 95885.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps, dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:35.277 default J demonbolt Fluffy_Pillow 97154.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:36.537 build_a_shard L shadow_bolt Fluffy_Pillow 96414.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:38.216 default F summon_vilefiend Fluffy_Pillow 96093.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:39.896 default H summon_demonic_tyrant Fluffy_Pillow 97773.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:41.577 default 8 potion Fluffy_Pillow 97454.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:41.577 build_a_shard L shadow_bolt Fluffy_Pillow 97454.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:43.255 default I hand_of_guldan Fluffy_Pillow 97132.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:44.509 build_a_shard L shadow_bolt Fluffy_Pillow 98386.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:46.178 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:47.847 build_a_shard L shadow_bolt Fluffy_Pillow 97673.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:49.516 build_a_shard L shadow_bolt Fluffy_Pillow 97342.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:51.176 default G call_dreadstalkers Fluffy_Pillow 97002.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:52.420 default I hand_of_guldan Fluffy_Pillow 98246.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:53.665 build_a_shard L shadow_bolt Fluffy_Pillow 99491.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:55.248 build_a_shard L shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:56.829 default J demonbolt Fluffy_Pillow 97586.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:58.017 default I hand_of_guldan Fluffy_Pillow 96774.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:59.203 default J demonbolt Fluffy_Pillow 97960.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
2:00.241 default I hand_of_guldan Fluffy_Pillow 96998.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
2:01.285 default B demonic_strength Fluffy_Pillow 98042.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect
2:02.333 default J demonbolt Fluffy_Pillow 99090.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect
2:03.388 default E grimoire_felguard Fluffy_Pillow 98145.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), supreme_commander, wild_imps(8), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
2:04.448 default J demonbolt Fluffy_Pillow 99205.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(4), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
2:05.583 default I hand_of_guldan Fluffy_Pillow 98340.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(3), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
2:06.719 default J demonbolt Fluffy_Pillow 99476.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(18), archive_of_the_titans(20)
2:07.861 default J demonbolt Fluffy_Pillow 98618.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(17), archive_of_the_titans(20)
2:09.008 build_a_shard L shadow_bolt Fluffy_Pillow 97765.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(15), archive_of_the_titans(20)
2:10.555 default I hand_of_guldan Fluffy_Pillow 97312.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(4), grimoire_felguard, quick_navigation, overwhelming_power(14), archive_of_the_titans(20)
2:11.722 default G call_dreadstalkers Fluffy_Pillow 98479.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), grimoire_felguard, quick_navigation, overwhelming_power(13), archive_of_the_titans(20)
2:12.898 default J demonbolt Fluffy_Pillow 99655.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation, overwhelming_power(12), archive_of_the_titans(20)
2:14.077 default I hand_of_guldan Fluffy_Pillow 98834.0/100000: 99% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20)
2:15.264 build_a_shard L shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
2:16.854 build_a_shard L shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
2:18.310 build_a_shard L shadow_bolt Fluffy_Pillow 97459.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
2:19.766 default I hand_of_guldan Fluffy_Pillow 96915.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
2:20.866 build_a_shard L shadow_bolt Fluffy_Pillow 98015.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
2:22.337 build_a_shard L shadow_bolt Fluffy_Pillow 97486.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
2:23.825 default J demonbolt Fluffy_Pillow 96974.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(20), archive_of_the_titans(20)
2:24.940 default F summon_vilefiend Fluffy_Pillow 96089.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(19), archive_of_the_titans(20)
2:26.433 default I hand_of_guldan Fluffy_Pillow 97582.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20)
2:27.569 default J demonbolt Fluffy_Pillow 98718.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20)
2:28.711 build_a_shard L shadow_bolt Fluffy_Pillow 97860.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
2:30.241 build_a_shard L shadow_bolt Fluffy_Pillow 97390.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), overwhelming_power(13), archive_of_the_titans(20)
2:31.777 default G call_dreadstalkers Fluffy_Pillow 96926.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20)
2:32.886 default I hand_of_guldan Fluffy_Pillow 98035.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
2:34.002 build_a_shard L shadow_bolt Fluffy_Pillow 99151.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20)
2:35.505 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20)
2:37.019 default J demonbolt Fluffy_Pillow 97518.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
2:38.166 default I hand_of_guldan Fluffy_Pillow 96665.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
2:39.319 build_a_shard L shadow_bolt Fluffy_Pillow 97818.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
2:40.866 build_a_shard L shadow_bolt Fluffy_Pillow 97365.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
2:42.422 build_a_shard L shadow_bolt Fluffy_Pillow 96921.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), overwhelming_power, archive_of_the_titans(20)
2:44.111 build_a_shard L shadow_bolt Fluffy_Pillow 96610.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(20)
2:45.811 nether_portal_building b hand_of_guldan Fluffy_Pillow 96310.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(20)
2:47.086 build_a_shard L shadow_bolt Fluffy_Pillow 97585.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(20)
2:48.774 build_a_shard L shadow_bolt Fluffy_Pillow 97273.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(20)
2:50.464 build_a_shard L shadow_bolt Fluffy_Pillow 96963.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(20)
2:52.153 nether_portal_building Z call_dreadstalkers Fluffy_Pillow 96652.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
2:53.253 nether_portal_building a hand_of_guldan Fluffy_Pillow 97752.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
2:54.357 build_a_shard L shadow_bolt Fluffy_Pillow 98856.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
2:55.837 build_a_shard L shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
2:57.325 build_a_shard L shadow_bolt Fluffy_Pillow 97493.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
2:58.828 build_a_shard L shadow_bolt Fluffy_Pillow 96996.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
3:00.341 nether_portal_building b hand_of_guldan Fluffy_Pillow 96509.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(17), archive_of_the_titans(20)
3:01.488 default B demonic_strength Fluffy_Pillow 97656.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(16), archive_of_the_titans(20)
3:02.643 build_a_shard L shadow_bolt Fluffy_Pillow 98811.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(15), archive_of_the_titans(20)
3:04.190 build_a_shard L shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
3:05.746 build_a_shard L shadow_bolt Fluffy_Pillow 97561.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(12), archive_of_the_titans(20)
3:07.312 nether_portal_building Y nether_portal Fluffy_Pillow 97127.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20)
3:08.500 nether_portal_active T hand_of_guldan Fluffy_Pillow 98315.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(3), portal_summons, quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
3:09.694 nether_portal_active T hand_of_guldan Fluffy_Pillow 99509.0/100000: 100% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(3), portal_summons(2), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20)
3:10.895 nether_portal_active W demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(2), portal_summons(3), quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
3:12.103 nether_portal_active Q summon_vilefiend Fluffy_Pillow 99208.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation(2), overwhelming_power(5), archive_of_the_titans(20)
3:13.731 nether_portal_active R call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(4), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
3:14.962 nether_portal_active U summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20)
3:16.611 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
3:16.611 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), overwhelming_power, archive_of_the_titans(20), ignition_mages_fuse
3:16.611 nether_portal_active W demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), overwhelming_power, archive_of_the_titans(20), ignition_mages_fuse
3:17.665 nether_portal_active T hand_of_guldan Fluffy_Pillow 97058.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:18.726 nether_portal_active W demonbolt Fluffy_Pillow 98119.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:19.786 nether_portal_active T hand_of_guldan Fluffy_Pillow 97179.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:20.846 build_a_shard L shadow_bolt Fluffy_Pillow 98239.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.215 nether_portal_active T hand_of_guldan Fluffy_Pillow 97608.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(2)
3:23.240 build_a_shard L shadow_bolt Fluffy_Pillow 98633.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(2)
3:24.601 nether_portal_active T hand_of_guldan Fluffy_Pillow 97994.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(2)
3:25.622 build_a_shard L shadow_bolt Fluffy_Pillow 99015.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.939 build_a_shard L shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:28.455 build_a_shard L shadow_bolt Fluffy_Pillow 97519.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:29.971 build_a_shard L shadow_bolt Fluffy_Pillow 97035.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(4)
3:31.441 build_a_shard L shadow_bolt Fluffy_Pillow 96505.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.913 default I hand_of_guldan Fluffy_Pillow 95977.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.986 default G call_dreadstalkers Fluffy_Pillow 97050.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.059 default J demonbolt Fluffy_Pillow 98123.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.132 default I hand_of_guldan Fluffy_Pillow 97196.0/100000: 97% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(5)
3:37.203 build_a_shard L shadow_bolt Fluffy_Pillow 98267.0/100000: 98% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
3:38.873 default J demonbolt Fluffy_Pillow 97937.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
3:40.125 default I hand_of_guldan Fluffy_Pillow 97189.0/100000: 97% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
3:41.378 default J demonbolt Fluffy_Pillow 98442.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
3:42.624 default J demonbolt Fluffy_Pillow 97688.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
3:43.869 default I hand_of_guldan Fluffy_Pillow 96933.0/100000: 97% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:45.115 default J demonbolt Fluffy_Pillow 98179.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:46.360 default I hand_of_guldan Fluffy_Pillow 97424.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
3:47.605 default J demonbolt Fluffy_Pillow 98669.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
3:48.849 default J demonbolt Fluffy_Pillow 97913.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
3:50.094 build_a_shard L shadow_bolt Fluffy_Pillow 97158.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(9), quick_navigation(4), archive_of_the_titans(20)
3:51.754 default I hand_of_guldan Fluffy_Pillow 96818.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
3:52.998 default J demonbolt Fluffy_Pillow 98062.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
3:54.243 default G call_dreadstalkers Fluffy_Pillow 97307.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
3:55.902 build_a_shard L shadow_bolt Fluffy_Pillow 98966.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:57.562 build_a_shard L shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:59.222 default F summon_vilefiend Fluffy_Pillow 97665.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:00.880 default I hand_of_guldan Fluffy_Pillow 99323.0/100000: 99% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:02.128 default B demonic_strength Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:03.315 build_a_shard L shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:04.896 default E grimoire_felguard Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:06.084 build_a_shard L shadow_bolt Fluffy_Pillow 99191.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:07.666 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:09.250 default J demonbolt Fluffy_Pillow 97588.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:10.437 default I hand_of_guldan Fluffy_Pillow 96775.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:11.624 default J demonbolt Fluffy_Pillow 97962.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps, vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:12.811 build_a_shard L shadow_bolt Fluffy_Pillow 97149.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps, vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:14.513 build_a_shard L shadow_bolt Fluffy_Pillow 96851.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:16.214 default G call_dreadstalkers Fluffy_Pillow 96552.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), grimoire_felguard, archive_of_the_titans(20)
4:17.491 default I hand_of_guldan Fluffy_Pillow 97829.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, archive_of_the_titans(20)
4:18.768 build_a_shard L shadow_bolt Fluffy_Pillow 99106.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, archive_of_the_titans(20)
4:20.468 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:22.156 default I hand_of_guldan Fluffy_Pillow 97692.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:23.417 default J demonbolt Fluffy_Pillow 98953.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:24.678 build_a_shard L shadow_bolt Fluffy_Pillow 98214.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:26.357 default I hand_of_guldan Fluffy_Pillow 97893.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:27.609 build_a_shard L shadow_bolt Fluffy_Pillow 99145.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:29.277 default J demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(5), quick_navigation(3), archive_of_the_titans(20)
4:30.529 default I hand_of_guldan Fluffy_Pillow 97255.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
4:31.781 build_a_shard L shadow_bolt Fluffy_Pillow 98507.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
4:33.450 default J demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
4:34.703 build_a_shard L shadow_bolt Fluffy_Pillow 97257.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
4:36.373 build_a_shard L shadow_bolt Fluffy_Pillow 96927.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
4:38.040 default G call_dreadstalkers Fluffy_Pillow 96594.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
4:39.292 default I hand_of_guldan Fluffy_Pillow 97846.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:40.544 default J demonbolt Fluffy_Pillow 99098.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:41.796 default I hand_of_guldan Fluffy_Pillow 98350.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(2), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:43.049 default J demonbolt Fluffy_Pillow 99603.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:44.293 build_a_shard L shadow_bolt Fluffy_Pillow 98847.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:45.952 default F summon_vilefiend Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:47.535 default H summon_demonic_tyrant Fluffy_Pillow 99587.0/100000: 100% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:49.118 build_a_shard L shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:50.701 default I hand_of_guldan Fluffy_Pillow 97588.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:51.891 default J demonbolt Fluffy_Pillow 98778.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:53.079 build_a_shard L shadow_bolt Fluffy_Pillow 97966.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:54.662 build_a_shard L shadow_bolt Fluffy_Pillow 97549.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:56.244 build_a_shard L shadow_bolt Fluffy_Pillow 97131.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20)
4:57.943 default G call_dreadstalkers Fluffy_Pillow 96830.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20)
4:59.316 default I hand_of_guldan Fluffy_Pillow 98203.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_GF_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DStr_GF_Imp : 17102 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17101.8 17101.8 16.1 / 0.094% 2300.2 / 13.5% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.4 954.5 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_GF_Imp 17102
Demonbolt 1256 7.4% 44.2 6.21sec 8521 7488 Direct 45.1 7109 14215 8362 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.24 45.08 0.00 0.00 1.1380 0.0000 376954.75 376954.75 0.00 7487.73 7487.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.13 82.36% 7109.38 6520 8308 7110.60 6908 7330 263955 263955 0.00
crit 7.95 17.64% 14214.88 13040 16616 14216.19 0 16616 113000 113000 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1053 6.2% 60.5 4.89sec 5225 4742 Direct 60.3 4446 8908 5236 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.46 60.34 0.00 0.00 1.1018 0.0000 315916.40 315916.40 0.00 4742.07 4742.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.66 82.30% 4446.21 1634 5979 4440.03 3988 4832 220808 220808 0.00
crit 10.68 17.70% 8908.20 3267 11958 8894.10 3448 11120 95108 95108 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (201) 0.8% (1.2%) 7.3 36.67sec 8291 0 Direct 7.3 4925 9849 5813 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.26 7.26 0.00 0.00 0.0000 0.0000 42176.00 42176.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 81.97% 4924.62 4925 4925 4922.65 0 4925 29289 29289 0.00
crit 1.31 18.03% 9849.24 9849 9849 7362.80 0 9849 12887 12887 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 36.67sec 2478 0 Direct 7.3 2111 4221 2478 17.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.26 7.26 0.00 0.00 0.0000 0.0000 17981.70 17981.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.99 82.58% 2110.55 2111 2111 2110.13 0 2111 12646 12646 0.00
crit 1.26 17.42% 4221.10 4221 4221 3085.40 0 4221 5336 5336 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1340 7.9% 95.7 3.06sec 4200 2812 Direct 95.0 3595 7190 4230 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.68 95.00 0.00 0.00 1.4937 0.0000 401846.97 401846.97 0.00 2811.83 2811.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.22 82.33% 3594.89 3373 4297 3595.45 3553 3642 281175 281175 0.00
crit 16.78 17.67% 7190.42 6745 8595 7191.06 6957 7624 120672 120672 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 288 1.7% 7.3 37.15sec 11875 0 Direct 7.2 10240 20481 12051 17.7%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.18 0.00 0.00 0.0000 0.0000 86528.55 86528.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.91 82.32% 10240.44 10240 10240 10230.20 0 10240 60533 60533 0.00
crit 1.27 17.68% 20480.88 20481 20481 14806.54 0 20481 25995 25995 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3148 / 3148
Firebolt 3148 18.4% 103.9 2.89sec 9080 6949 Direct 103.1 7775 15554 9153 17.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.88 103.06 0.00 0.00 1.3067 0.0000 943213.34 943213.34 0.00 6948.83 6948.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.80 82.29% 7774.60 7027 9401 7775.86 7630 7926 659310 659310 0.00
crit 18.25 17.71% 15553.82 14053 18802 15557.53 14668 17455 283903 283903 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - grimoire_felguard 4764 / 1032
Felstorm 651 0.8% 3.9 80.76sec 10634 3637 Periodic 19.5 1830 3660 2153 17.7% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 19.46 19.46 2.9245 0.5922 41908.02 59912.54 30.05 3636.59 3636.59
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.33% 1829.87 1715 2197 1830.52 1772 1989 29320 41917 30.05
crit 3.4 17.67% 3660.35 3430 4393 3572.23 0 4393 12588 17996 29.32
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1849 2.3% 18.5 13.88sec 6448 6449 Direct 18.5 5478 10958 6448 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.46 18.46 0.00 0.00 1.0000 0.0000 119020.51 170154.11 30.05 6448.53 6448.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.19 82.29% 5478.08 5020 6430 5480.47 5231 5908 83204 118949 30.05
crit 3.27 17.71% 10957.83 10040 12861 10651.32 0 12554 35817 51205 29.20
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2263 2.8% 41.0 6.35sec 3554 3005 Direct 41.0 3021 6040 3554 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.96 40.96 0.00 0.00 1.1828 0.0000 145574.29 208115.93 30.05 3005.13 3005.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.72 82.33% 3021.06 2744 3515 3021.97 2916 3208 101869 145634 30.05
crit 7.24 17.67% 6039.63 5488 7030 6040.86 5488 6784 43705 62482 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - bilescourge 3941 / 528
Toxic Bile 3941 3.1% 55.2 2.07sec 2826 3036 Direct 55.2 2401 4801 2826 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.24 55.24 0.00 0.00 0.9306 0.0000 156096.47 156096.47 0.00 3036.48 3036.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.47 82.31% 2401.24 2116 2582 2403.21 2116 2571 109190 109190 0.00
crit 9.77 17.69% 4800.80 4233 5163 4781.34 0 5163 46906 46906 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - urzul 1340 / 179
Many Faced Bite 499 0.4% 9.4 12.16sec 2107 2107 Direct 9.4 1793 3585 2107 17.5%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.39 9.39 0.00 0.00 1.0000 0.0000 19787.00 28287.90 30.05 2106.79 2106.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.75 82.49% 1792.85 1586 1935 1792.87 0 1935 13891 19858 29.99
crit 1.64 17.51% 3585.18 3172 3870 2709.16 0 3870 5896 8430 22.71
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 841 0.6% 42.3 2.61sec 782 665 Direct 42.3 665 1330 782 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.33 42.33 0.00 0.00 1.1750 0.0000 33088.93 47304.60 30.05 665.24 665.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.90 82.45% 664.84 587 717 665.71 587 714 23205 33174 30.05
crit 7.43 17.55% 1330.49 1175 1433 1311.63 0 1433 9884 14131 29.58
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3207 / 1517
Bile Spit 1167 3.2% 6.8 47.23sec 24258 0 Direct 6.8 8927 17882 10482 17.4%  
Periodic 33.2 2821 0 2821 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.79 6.78 33.19 33.19 0.0000 2.0000 164703.57 164703.57 0.00 2481.37 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.60 82.63% 8927.10 8474 10104 8926.00 8505 9801 50018 50018 0.00
crit 1.18 17.37% 17881.78 16947 20207 12893.14 0 20207 21055 21055 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.2 100.00% 2821.18 2502 3310 2821.90 2633 2885 93630 93630 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.0% 28.5 10.28sec 3653 3653 Direct 28.5 3104 6217 3653 17.6%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.52 28.52 0.00 0.00 1.0000 0.0000 104179.08 148936.51 30.05 3653.48 3653.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.49 82.36% 3104.48 2737 3621 3105.86 2948 3270 72911 104235 30.05
crit 5.03 17.64% 6216.51 5474 7243 6187.35 0 7243 31268 44702 29.90
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1306 3.6% 102.8 2.82sec 1800 1353 Direct 102.8 1530 3061 1800 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.83 102.83 0.00 0.00 1.3302 0.0000 185117.71 264647.99 30.05 1353.42 1353.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.71 82.37% 1530.43 1337 1775 1531.02 1480 1569 129635 185329 30.05
crit 18.12 17.63% 3061.27 2673 3550 3062.54 2837 3377 55482 79319 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3375 / 2231
Dreadbite 1068 4.1% 29.1 20.93sec 7272 0 Direct 29.1 6176 12340 7272 17.8%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.10 29.10 0.00 0.00 0.0000 0.0000 211585.68 211585.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.92 82.21% 6175.78 5711 7613 6176.00 5971 6431 147726 147726 0.00
crit 5.17 17.79% 12340.44 11423 15227 12280.41 0 15227 63860 63860 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2307 8.9% 312.3 1.89sec 1464 1106 Direct 312.3 1244 2489 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.34 312.34 0.00 0.00 1.3233 0.0000 457287.11 653746.84 30.05 1106.40 1106.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.06 82.30% 1243.71 1101 1473 1243.89 1227 1263 319710 457064 30.05
crit 55.28 17.70% 2488.62 2203 2947 2489.03 2379 2633 137577 196682 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - darkhound 1320 / 176
Fel Bite 474 0.4% 8.9 13.13sec 2113 2113 Direct 8.9 1795 3590 2113 17.7%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.93 8.93 0.00 0.00 1.0000 0.0000 18870.26 26977.30 30.05 2112.66 2112.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.35 82.31% 1795.13 1586 1935 1795.15 0 1935 13198 18869 29.97
crit 1.58 17.69% 3590.31 3172 3870 2715.54 0 3870 5672 8108 22.70
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 845 0.7% 42.7 2.65sec 781 666 Direct 42.7 665 1329 781 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.75 42.75 0.00 0.00 1.1734 0.0000 33388.38 47732.70 30.05 665.60 665.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.28 82.52% 664.92 587 717 665.77 587 714 23455 33532 30.05
crit 7.47 17.48% 1329.24 1175 1433 1313.41 0 1433 9933 14201 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wild_imp 2578 / 2479
Fel Firebolt 2578 14.5% 996.0 0.29sec 747 502 Direct 991.9 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 995.98 991.86 0.00 0.00 1.4871 0.0000 743578.34 743578.34 0.00 502.04 502.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 816.39 82.31% 637.02 569 761 637.04 627 649 520058 520058 0.00
crit 175.46 17.69% 1273.87 1138 1523 1273.91 1241 1312 223521 223521 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4665 / 824
Demonfire 4665 4.8% 37.8 6.91sec 6533 4896 Direct 37.7 5561 11122 6547 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.77 37.69 0.00 0.00 1.3345 0.0000 246749.31 246749.31 0.00 4895.63 4895.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.00 82.26% 5560.65 5312 5917 5563.95 5469 5671 172372 172372 0.00
crit 6.69 17.74% 11122.36 10624 11834 11124.39 0 11834 74377 74377 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - void_terror 1829 / 245
Double Breath 0 (133) 0.0% (0.8%) 0.0 0.00sec 0 7404

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7403.96 7403.96
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 495 0.4% 7.0 17.06sec 2808 0 Direct 7.0 2389 4782 2808 17.5%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 19652.98 19652.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.77 82.50% 2388.86 2116 2582 2379.20 0 2582 13795 13795 0.00
crit 1.23 17.50% 4782.13 4233 5163 3233.89 0 5163 5858 5858 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 494 0.4% 7.0 17.06sec 2807 0 Direct 7.0 2389 4776 2807 17.5%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.0000 0.0000 19647.22 19647.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.78 82.51% 2389.49 2116 2582 2385.98 0 2582 13801 13801 0.00
crit 1.22 17.49% 4776.10 4233 5163 3219.37 0 5163 5847 5847 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 841 0.6% 42.5 2.62sec 782 666 Direct 42.5 665 1329 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.49 42.49 0.00 0.00 1.1749 0.0000 33224.44 47498.32 30.05 665.55 665.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.01 82.40% 665.00 587 717 665.74 587 714 23283 33286 30.05
crit 7.48 17.60% 1329.18 1175 1433 1312.04 0 1433 9942 14213 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1070 / 142
Demon Fangs 661 0.5% 9.3 12.34sec 2819 2819 Direct 9.3 2393 4787 2819 17.8%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.25 9.25 0.00 0.00 1.0000 0.0000 26075.22 26075.22 0.00 2818.94 2818.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.61 82.22% 2393.34 2116 2582 2390.70 0 2582 18202 18202 0.00
crit 1.64 17.78% 4786.94 4233 5163 3651.03 0 5163 7873 7873 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 409 0.3% 81.9 1.34sec 196 326 Direct 81.9 167 333 196 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.85 81.85 0.00 0.00 0.6017 0.0000 16042.99 22935.38 30.05 325.75 325.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.39 82.33% 166.56 147 179 166.66 147 178 11225 16047 30.05
crit 14.46 17.67% 333.20 294 358 332.87 0 358 4818 6888 30.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - wrathguard 1722 / 230
melee 836 0.6% 42.1 2.68sec 782 666 Direct 42.1 665 1330 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.07 42.07 0.00 0.00 1.1746 0.0000 32900.35 47035.01 30.05 665.80 665.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.67 82.40% 665.02 587 717 665.87 587 714 23053 32958 30.05
crit 7.40 17.60% 1330.05 1175 1433 1312.03 0 1433 9847 14077 29.61
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 419 0.3% 42.1 2.68sec 392 315 Direct 42.1 332 665 392 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.07 42.07 0.00 0.00 1.2419 0.0000 16481.38 23562.11 30.05 315.47 315.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.57 82.19% 332.48 294 358 332.91 294 357 11496 16434 30.05
crit 7.49 17.81% 665.29 587 717 657.65 0 717 4986 7128 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 467 0.4% 8.8 13.35sec 2116 2116 Direct 8.8 1796 3591 2116 17.8%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.77 8.77 0.00 0.00 1.0000 0.0000 18554.09 26525.30 30.05 2116.11 2116.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.20 82.16% 1795.74 1586 1935 1797.02 0 1935 12937 18495 30.00
crit 1.56 17.84% 3591.17 3172 3870 2685.38 0 3870 5617 8030 22.46
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - shivarra 1945 / 259
melee 839 0.6% 42.3 2.70sec 782 664 Direct 42.3 665 1329 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.29 42.29 0.00 0.00 1.1768 0.0000 33054.06 47254.75 30.05 664.20 664.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.84 82.40% 664.65 587 717 665.35 587 714 23158 33107 30.05
crit 7.44 17.60% 1329.27 1175 1433 1307.83 0 1433 9896 14147 29.54
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 419 0.3% 42.3 2.70sec 391 314 Direct 42.3 332 665 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.29 42.29 0.00 0.00 1.2447 0.0000 16535.03 23638.81 30.05 314.16 314.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.82 82.34% 332.32 294 358 332.66 294 357 11571 16542 30.05
crit 7.47 17.66% 664.69 587 717 653.86 0 717 4964 7097 29.53
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (92) 0.0% (0.5%) 0.0 0.00sec 0 3976

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3976.19 3976.19
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 172 0.1% 6.8 18.01sec 995 0 Direct 6.8 843 1689 995 17.9%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 0.0000 0.0000 6801.24 9723.19 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.61 82.06% 843.44 749 914 840.52 0 914 4730 6762 29.90
crit 1.23 17.94% 1689.16 1498 1827 1142.94 0 1827 2071 2961 20.31
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 171 0.1% 6.8 18.01sec 991 0 Direct 6.8 844 1687 991 17.5%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 0.0000 0.0000 6773.12 9682.99 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.64 82.52% 843.69 749 914 842.21 0 914 4758 6802 29.94
crit 1.19 17.48% 1686.88 1498 1827 1124.84 0 1827 2015 2881 20.02
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 172 0.1% 6.8 18.01sec 996 0 Direct 6.8 844 1686 996 18.1%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 0.0000 0.0000 6805.56 9729.37 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.60 81.94% 843.83 749 914 841.02 0 914 4725 6756 29.91
crit 1.23 18.06% 1685.68 1498 1827 1152.70 0 1827 2080 2974 20.54
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 171 0.1% 6.8 18.01sec 994 0 Direct 6.8 844 1687 994 17.8%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 0.0000 0.0000 6793.33 9711.88 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.62 82.17% 843.67 749 914 842.08 0 914 4738 6773 29.94
crit 1.22 17.83% 1687.04 1498 1827 1136.92 0 1827 2056 2939 20.25
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - illidari_satyr 1283 / 173
melee 423 0.3% 43.0 2.66sec 391 332 Direct 43.0 332 665 391 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.05 43.05 0.00 0.00 1.1764 0.0000 16836.35 24069.58 30.05 332.46 332.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.44 82.32% 332.33 294 358 332.62 294 357 11778 16837 30.05
crit 7.61 17.68% 664.82 587 717 657.21 0 717 5059 7232 29.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 211 0.2% 43.0 2.66sec 195 157 Direct 43.0 166 332 195 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.05 43.05 0.00 0.00 1.2439 0.0000 8409.11 12021.84 30.05 157.04 157.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.49 82.44% 166.19 147 179 166.33 147 178 5898 8432 30.05
crit 7.56 17.56% 332.16 294 358 328.28 0 358 2511 3590 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 648 0.5% 9.2 12.86sec 2822 2822 Direct 9.2 2395 4789 2822 17.8%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.21 9.21 0.00 0.00 1.0000 0.0000 25996.83 25996.83 0.00 2822.06 2822.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.57 82.16% 2394.90 2116 2582 2391.32 0 2582 18128 18128 0.00
crit 1.64 17.84% 4788.63 4233 5163 3661.84 0 5163 7869 7869 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - prince_malchezaar 4674 / 401
melee 3110 1.6% 21.6 1.31sec 3680 3126 Direct 21.6 3145 6306 3680 16.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.59 21.59 0.00 0.00 1.1776 0.0000 79466.09 113606.32 30.05 3125.51 3125.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.93 83.06% 3145.22 2784 3396 3150.31 2784 3381 56408 80642 30.05
crit 3.66 16.94% 6305.76 5567 6791 6106.21 0 6791 23058 32965 29.07
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1564 0.8% 21.6 1.31sec 1845 1483 Direct 21.6 1573 3147 1845 17.3%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.59 21.59 0.00 0.00 1.2444 0.0000 39846.47 56965.31 30.05 1483.10 1483.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.86 82.70% 1573.16 1392 1698 1575.84 1392 1690 28090 40159 30.05
crit 3.74 17.30% 3147.48 2784 3396 3055.22 0 3392 11756 16807 29.15
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 991 / 81
Eye of Gul'dan 991 0.5% 27.6 4.71sec 871 1146 Periodic 60.0 400 0 400 0.0% 58.7%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.56 0.00 59.99 59.99 0.7602 2.9375 24009.17 24009.17 0.00 121.76 1145.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.0 100.00% 400.18 181 461 399.23 379 410 24009 24009 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DStr_GF_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.29sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.93sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.61 0.00 0.00 0.00 1.2018 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.74sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1272 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2375 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.50sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 1.5107 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 15.2 14.66sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.15 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.23sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.79 0.00 0.00 0.00 1.5387 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.20sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 8.45% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.4 23.2sec 10.2sec 51.81% 83.64% 15.4(15.4) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.81%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.4 30.1 12.3sec 5.3sec 38.70% 100.00% 4.4(4.4) 0.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.84%
  • demonic_core_2:15.66%
  • demonic_core_3:5.09%
  • demonic_core_4:2.11%

Trigger Attempt Success

  • trigger_pct:25.77%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.7 26.6sec 10.1sec 66.09% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.65%
  • dreadstalkers_4:6.44%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.4 181.1sec 1.8sec 1.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.17%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.7sec 120.7sec 19.75% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.6sec 171.6sec 14.88% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.89%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.26% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 67.0sec 36.6sec 44.19% 0.00% 3.0(41.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.34%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.41%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.56%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.15%
  • overwhelming_power_21:2.22%
  • overwhelming_power_22:2.28%
  • overwhelming_power_23:2.35%
  • overwhelming_power_24:2.41%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.2 182.8sec 14.7sec 19.61% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.01%
  • portal_summons_2:0.76%
  • portal_summons_3:1.26%
  • portal_summons_4:1.96%
  • portal_summons_5:1.37%
  • portal_summons_6:1.75%
  • portal_summons_7:4.30%
  • portal_summons_8:6.15%
  • portal_summons_9:0.06%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 183.1sec 88.5sec 1.20% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.21%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.63%
  • quick_navigation_2:17.24%
  • quick_navigation_3:16.66%
  • quick_navigation_4:16.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.2sec 52.2sec 17.51% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 80.0sec 17.08% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.42% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.42%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.8 55.9sec 0.0sec 96.14% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.30%
  • wild_imps_2:2.73%
  • wild_imps_3:28.82%
  • wild_imps_4:7.67%
  • wild_imps_5:9.48%
  • wild_imps_6:26.10%
  • wild_imps_7:5.86%
  • wild_imps_8:3.96%
  • wild_imps_9:4.81%
  • wild_imps_10:1.51%
  • wild_imps_11:1.15%
  • wild_imps_12:1.09%
  • wild_imps_13:0.43%
  • wild_imps_14:0.18%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.7sec 120.7sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.2 13.9sec
one_shard_hog 8.9 21.7sec
two_shard_hog 3.8 16.2sec
three_shard_hog 47.8 5.8sec
portal_summon 15.2 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_GF_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 45.2 90472.1 2000.0 2045.1 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.5 159.8 2.6 2.6 1976.5
shadow_bolt Mana 95.7 191365.2 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7204.9 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.9 4155.2 40.0 40.0 227.0
pet - grimoire_felguard
felstorm Energy 3.9 236.5 60.0 60.0 177.2
legion_strike Energy 18.5 1107.5 60.0 60.0 107.5
pet - wild_imp
fel_firebolt Energy 995.9 15601.8 15.7 15.7 47.7
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.24 90.46 (48.60%) 2.00 0.01 0.01%
shadow_bolt Soul Shard 95.68 95.68 (51.40%) 1.00 0.00 0.00%
mana_regen Mana 555.09 286348.83 (100.00%) 515.86 13119.33 4.38%
pet - imp
energy_regen Energy 427.79 3984.27 (100.00%) 9.31 22.74 0.57%
pet - grimoire_felguard
energy_regen Energy 91.70 914.49 (100.00%) 9.97 48.45 5.03%
pet - bilescourge
energy_regen Energy 13.04 0.00 (0.00%) 0.00 181.82 100.00%
pet - demonic_tyrant
energy_regen Energy 37.77 0.00 (0.00%) 0.00 762.49 100.00%
pet - bilescourge
energy_regen Energy 11.11 0.00 (0.00%) 0.00 153.94 100.00%
pet - bilescourge
energy_regen Energy 13.06 0.00 (0.00%) 0.00 181.90 100.00%
pet - bilescourge
energy_regen Energy 10.90 0.00 (0.00%) 0.00 151.30 100.00%
pet - bilescourge
energy_regen Energy 3.58 0.00 (0.00%) 0.00 49.59 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.46 963.44
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97292.97 93577.00 100000.00
Soul Shard 2.57 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.6%

Statistics & Data Analysis

Fight Length
Sample Data DStr_GF_Imp Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_GF_Imp Damage Per Second
Count 4999
Mean 17101.81
Minimum 14835.64
Maximum 19291.77
Spread ( max - min ) 4456.14
Range [ ( max - min ) / 2 * 100% ] 13.03%
Standard Deviation 580.3361
5th Percentile 16231.63
95th Percentile 18138.70
( 95th Percentile - 5th Percentile ) 1907.07
Mean Distribution
Standard Deviation 8.2080
95.00% Confidence Intervall ( 17085.72 - 17117.89 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4424
0.1 Scale Factor Error with Delta=300 2876
0.05 Scale Factor Error with Delta=300 11501
0.01 Scale Factor Error with Delta=300 287504
Priority Target DPS
Sample Data DStr_GF_Imp Priority Target Damage Per Second
Count 4999
Mean 17101.81
Minimum 14835.64
Maximum 19291.77
Spread ( max - min ) 4456.14
Range [ ( max - min ) / 2 * 100% ] 13.03%
Standard Deviation 580.3361
5th Percentile 16231.63
95th Percentile 18138.70
( 95th Percentile - 5th Percentile ) 1907.07
Mean Distribution
Standard Deviation 8.2080
95.00% Confidence Intervall ( 17085.72 - 17117.89 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4424
0.1 Scale Factor Error with Delta=300 2876
0.05 Scale Factor Error with Delta=300 11501
0.01 Scale Factor Error with Delta=300 287504
DPS(e)
Sample Data DStr_GF_Imp Damage Per Second (Effective)
Count 4999
Mean 17101.81
Minimum 14835.64
Maximum 19291.77
Spread ( max - min ) 4456.14
Range [ ( max - min ) / 2 * 100% ] 13.03%
Damage
Sample Data DStr_GF_Imp Damage
Count 4999
Mean 1241404.36
Minimum 893755.33
Maximum 1651606.91
Spread ( max - min ) 757851.57
Range [ ( max - min ) / 2 * 100% ] 30.52%
DTPS
Sample Data DStr_GF_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_GF_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_GF_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_GF_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_GF_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_GF_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_GF_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_GF_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.82 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.60 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.64 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.50 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.43 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.19 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.71 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.93 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.05 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.80 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.53 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.94 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKSKKKIHKFKHKKKHIIHIHIIHKIKHIFKEHKKKHKIHIIKHFKKHKKKHKKKKKHFIHIIKEG8HKKHKKFKKHIIHIHIDIHIIKFHIHKKKHKKEIHIIKFHKKKHKKKKKaKKYZKKKKKXSSVST9AVPQKSKSKSKKKHIIHIKKHFIHKKKHIKHIIHKKFKIHEKDKKHIIKHFIHKKKHKKKHKIIFHIHKIGKKEHKKKKFHK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.278 nether_portal_active O grimoire_felguard Fluffy_Pillow 99278.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.258 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.566 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:04.865 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:05.841 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.142 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.142 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.142 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.238 nether_portal_active S hand_of_guldan Fluffy_Pillow 97101.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.059 build_a_shard K shadow_bolt Fluffy_Pillow 97922.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.155 nether_portal_active S hand_of_guldan Fluffy_Pillow 97018.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.977 build_a_shard K shadow_bolt Fluffy_Pillow 97840.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.072 nether_portal_active S hand_of_guldan Fluffy_Pillow 96935.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.869 build_a_shard K shadow_bolt Fluffy_Pillow 97732.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation, overwhelming_power(25), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.793 nether_portal_active S hand_of_guldan Fluffy_Pillow 96656.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation, overwhelming_power(24), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.547 build_a_shard K shadow_bolt Fluffy_Pillow 97410.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(23), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.482 nether_portal_active S hand_of_guldan Fluffy_Pillow 96345.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(22), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.236 build_a_shard K shadow_bolt Fluffy_Pillow 97099.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(21), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.154 nether_portal_active S hand_of_guldan Fluffy_Pillow 96017.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(20), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.951 build_a_shard K shadow_bolt Fluffy_Pillow 96814.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(20), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.012 nether_portal_active S hand_of_guldan Fluffy_Pillow 95875.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(18), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.817 build_a_shard K shadow_bolt Fluffy_Pillow 96680.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(18), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.860 build_a_shard K shadow_bolt Fluffy_Pillow 95723.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.903 build_a_shard K shadow_bolt Fluffy_Pillow 94766.0/100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.954 default I demonbolt Fluffy_Pillow 93817.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.745 default H hand_of_guldan Fluffy_Pillow 92608.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(5), ignition_mages_fuse(5)
0:24.519 build_a_shard K shadow_bolt Fluffy_Pillow 93382.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.553 default F call_dreadstalkers Fluffy_Pillow 92416.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(12), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.334 build_a_shard K shadow_bolt Fluffy_Pillow 93197.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(11), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.380 default H hand_of_guldan Fluffy_Pillow 92243.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(6)
0:28.295 build_a_shard K shadow_bolt Fluffy_Pillow 93158.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(6)
0:29.521 build_a_shard K shadow_bolt Fluffy_Pillow 92384.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(2), overwhelming_power(8), archive_of_the_titans(6)
0:30.753 build_a_shard K shadow_bolt Fluffy_Pillow 91616.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(2), overwhelming_power(7), archive_of_the_titans(7)
0:31.993 default H hand_of_guldan Fluffy_Pillow 90856.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(6), archive_of_the_titans(7)
0:32.929 default I demonbolt Fluffy_Pillow 91792.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(5), archive_of_the_titans(7)
0:33.871 default I demonbolt Fluffy_Pillow 90734.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(7)
0:34.818 default H hand_of_guldan Fluffy_Pillow 89681.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(3), archive_of_the_titans(7)
0:35.770 default I demonbolt Fluffy_Pillow 90633.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(8)
0:36.727 default H hand_of_guldan Fluffy_Pillow 89590.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power, archive_of_the_titans(8)
0:37.691 default I demonbolt Fluffy_Pillow 90554.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(3), archive_of_the_titans(8)
0:38.657 default I demonbolt Fluffy_Pillow 89520.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(8)
0:39.622 default H hand_of_guldan Fluffy_Pillow 88485.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, wild_imps(9), quick_navigation(3), overwhelming_power(24), archive_of_the_titans(8)
0:40.465 build_a_shard K shadow_bolt Fluffy_Pillow 89328.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, wild_imps(8), quick_navigation(3), overwhelming_power(23), archive_of_the_titans(9)
0:41.592 default I demonbolt Fluffy_Pillow 88455.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(9)
0:42.697 build_a_shard K shadow_bolt Fluffy_Pillow 87560.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(9), quick_navigation(3), overwhelming_power(21), archive_of_the_titans(9)
0:44.177 default H hand_of_guldan Fluffy_Pillow 87040.0/100000: 87% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(3), overwhelming_power(19), archive_of_the_titans(9)
0:45.301 default I demonbolt Fluffy_Pillow 88164.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(10)
0:46.429 default F call_dreadstalkers Fluffy_Pillow 87292.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(10)
0:47.565 build_a_shard K shadow_bolt Fluffy_Pillow 88428.0/100000: 88% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(10)
0:49.086 default E summon_vilefiend Fluffy_Pillow 87949.0/100000: 88% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(10)
0:50.615 default H hand_of_guldan Fluffy_Pillow 89478.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(13), archive_of_the_titans(11)
0:51.768 build_a_shard K shadow_bolt Fluffy_Pillow 90631.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(12), archive_of_the_titans(11)
0:53.315 build_a_shard K shadow_bolt Fluffy_Pillow 90178.0/100000: 90% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(10), archive_of_the_titans(11)
0:54.878 build_a_shard K shadow_bolt Fluffy_Pillow 89741.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(9), archive_of_the_titans(11)
0:56.452 default H hand_of_guldan Fluffy_Pillow 89315.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(7), archive_of_the_titans(12)
0:57.648 build_a_shard K shadow_bolt Fluffy_Pillow 90511.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(6), archive_of_the_titans(12)
0:59.178 default I demonbolt Fluffy_Pillow 90041.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), vilefiend, quick_navigation_final, overwhelming_power(4), archive_of_the_titans(12)
1:00.338 default H hand_of_guldan Fluffy_Pillow 89201.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(3), archive_of_the_titans(13)
1:01.506 default I demonbolt Fluffy_Pillow 90369.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation_final, overwhelming_power(2), archive_of_the_titans(13)
1:02.683 default I demonbolt Fluffy_Pillow 89546.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power, archive_of_the_titans(13)
1:03.865 build_a_shard K shadow_bolt Fluffy_Pillow 88728.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, archive_of_the_titans(13)
1:05.447 default H hand_of_guldan Fluffy_Pillow 88310.0/100000: 88% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, archive_of_the_titans(14)
1:06.634 default F call_dreadstalkers Fluffy_Pillow 89497.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(14)
1:07.820 build_a_shard K shadow_bolt Fluffy_Pillow 90683.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), archive_of_the_titans(14)
1:09.520 build_a_shard K shadow_bolt Fluffy_Pillow 90383.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(14)
1:11.221 default H hand_of_guldan Fluffy_Pillow 90084.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), archive_of_the_titans(15)
1:12.496 build_a_shard K shadow_bolt Fluffy_Pillow 91359.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), archive_of_the_titans(15)
1:14.196 build_a_shard K shadow_bolt Fluffy_Pillow 91059.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), archive_of_the_titans(15)
1:15.898 build_a_shard K shadow_bolt Fluffy_Pillow 90761.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(16)
1:17.600 default H hand_of_guldan Fluffy_Pillow 90463.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), archive_of_the_titans(16)
1:18.878 build_a_shard K shadow_bolt Fluffy_Pillow 91741.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), archive_of_the_titans(16)
1:20.580 build_a_shard K shadow_bolt Fluffy_Pillow 91443.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), archive_of_the_titans(17)
1:22.280 build_a_shard K shadow_bolt Fluffy_Pillow 91143.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), archive_of_the_titans(17)
1:23.980 build_a_shard K shadow_bolt Fluffy_Pillow 90843.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(17)
1:25.680 build_a_shard K shadow_bolt Fluffy_Pillow 90543.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(18)
1:27.379 default H hand_of_guldan Fluffy_Pillow 90242.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(18)
1:28.647 default F call_dreadstalkers Fluffy_Pillow 91510.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation, archive_of_the_titans(18)
1:29.914 default I demonbolt Fluffy_Pillow 92777.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps, dreadstalkers(2), quick_navigation, archive_of_the_titans(18)
1:31.182 default H hand_of_guldan Fluffy_Pillow 92045.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:32.450 default I demonbolt Fluffy_Pillow 93313.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:33.716 default I demonbolt Fluffy_Pillow 92579.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:34.983 build_a_shard K shadow_bolt Fluffy_Pillow 91846.0/100000: 92% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:36.673 default E summon_vilefiend Fluffy_Pillow 91536.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:38.354 default G summon_demonic_tyrant Fluffy_Pillow 93217.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:40.034 default 8 potion Fluffy_Pillow 92897.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:40.034 default H hand_of_guldan Fluffy_Pillow 92897.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:41.296 build_a_shard K shadow_bolt Fluffy_Pillow 94159.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:42.975 build_a_shard K shadow_bolt Fluffy_Pillow 93838.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:44.645 default H hand_of_guldan Fluffy_Pillow 93508.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:45.898 build_a_shard K shadow_bolt Fluffy_Pillow 94761.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:47.567 build_a_shard K shadow_bolt Fluffy_Pillow 94430.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:49.236 default F call_dreadstalkers Fluffy_Pillow 94099.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:50.480 build_a_shard K shadow_bolt Fluffy_Pillow 95343.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:52.138 build_a_shard K shadow_bolt Fluffy_Pillow 95001.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:53.797 default H hand_of_guldan Fluffy_Pillow 94660.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:55.041 default I demonbolt Fluffy_Pillow 95904.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:56.287 default I demonbolt Fluffy_Pillow 95150.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:57.531 default H hand_of_guldan Fluffy_Pillow 94394.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:58.775 default I demonbolt Fluffy_Pillow 95638.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:00.020 default H hand_of_guldan Fluffy_Pillow 94883.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:01.264 default I demonbolt Fluffy_Pillow 96127.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(12), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:02.509 default D grimoire_felguard Fluffy_Pillow 95372.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(10), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:03.754 default I demonbolt Fluffy_Pillow 96617.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(9), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:04.999 default H hand_of_guldan Fluffy_Pillow 95862.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:06.245 default I demonbolt Fluffy_Pillow 97108.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
2:07.491 default I demonbolt Fluffy_Pillow 96354.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
2:08.736 build_a_shard K shadow_bolt Fluffy_Pillow 95599.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
2:10.395 default F call_dreadstalkers Fluffy_Pillow 95258.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(6), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:11.583 default H hand_of_guldan Fluffy_Pillow 96446.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:12.771 default I demonbolt Fluffy_Pillow 97634.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:13.959 default H hand_of_guldan Fluffy_Pillow 96822.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:15.147 build_a_shard K shadow_bolt Fluffy_Pillow 98010.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
2:16.530 build_a_shard K shadow_bolt Fluffy_Pillow 97393.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
2:17.919 build_a_shard K shadow_bolt Fluffy_Pillow 96782.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
2:19.315 default H hand_of_guldan Fluffy_Pillow 96178.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:20.375 build_a_shard K shadow_bolt Fluffy_Pillow 97238.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:21.795 build_a_shard K shadow_bolt Fluffy_Pillow 96658.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), overwhelming_power(19), archive_of_the_titans(20)
2:23.315 default E summon_vilefiend Fluffy_Pillow 96178.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), overwhelming_power(17), archive_of_the_titans(20)
2:24.886 default I demonbolt Fluffy_Pillow 97749.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(3), vilefiend, overwhelming_power(16), archive_of_the_titans(20)
2:26.048 default H hand_of_guldan Fluffy_Pillow 96911.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), vilefiend, overwhelming_power(14), archive_of_the_titans(20)
2:27.220 default I demonbolt Fluffy_Pillow 98083.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, overwhelming_power(13), archive_of_the_titans(20)
2:28.400 default I demonbolt Fluffy_Pillow 97263.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), vilefiend, overwhelming_power(12), archive_of_the_titans(20)
2:29.586 build_a_shard K shadow_bolt Fluffy_Pillow 96449.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(5), vilefiend, overwhelming_power(11), archive_of_the_titans(20)
2:31.176 default F call_dreadstalkers Fluffy_Pillow 96039.0/100000: 96% mana | 5.0/5: 100% soul_shard wild_imps(3), vilefiend, overwhelming_power(9), archive_of_the_titans(20)
2:32.785 default H hand_of_guldan Fluffy_Pillow 97648.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(8), archive_of_the_titans(20)
2:34.000 build_a_shard K shadow_bolt Fluffy_Pillow 98863.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(6), archive_of_the_titans(20)
2:35.640 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, overwhelming_power(5), archive_of_the_titans(20)
2:37.289 build_a_shard K shadow_bolt Fluffy_Pillow 97654.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(3), archive_of_the_titans(20)
2:38.958 default H hand_of_guldan Fluffy_Pillow 97323.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(2), archive_of_the_titans(20)
2:40.218 build_a_shard K shadow_bolt Fluffy_Pillow 98583.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
2:41.919 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:43.608 build_a_shard K shadow_bolt Fluffy_Pillow 97694.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:45.297 build_a_shard K shadow_bolt Fluffy_Pillow 97383.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(20)
2:46.986 build_a_shard K shadow_bolt Fluffy_Pillow 97072.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(20)
2:48.675 nether_portal_building a hand_of_guldan Fluffy_Pillow 96761.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(20)
2:49.944 build_a_shard K shadow_bolt Fluffy_Pillow 98030.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(2), quick_navigation, archive_of_the_titans(20)
2:51.632 build_a_shard K shadow_bolt Fluffy_Pillow 97718.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(2), quick_navigation(2), archive_of_the_titans(20)
2:53.311 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 97397.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
2:54.571 nether_portal_building Z hand_of_guldan Fluffy_Pillow 98657.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:55.832 build_a_shard K shadow_bolt Fluffy_Pillow 99918.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:57.511 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:59.191 build_a_shard K shadow_bolt Fluffy_Pillow 97684.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:00.870 build_a_shard K shadow_bolt Fluffy_Pillow 97363.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:02.549 build_a_shard K shadow_bolt Fluffy_Pillow 97042.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:04.228 nether_portal_building X nether_portal Fluffy_Pillow 96721.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:05.489 nether_portal_active S hand_of_guldan Fluffy_Pillow 97982.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(2), portal_summons, quick_navigation(2), archive_of_the_titans(20)
3:06.749 nether_portal_active S hand_of_guldan Fluffy_Pillow 99242.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, portal_summons(2), quick_navigation(3), archive_of_the_titans(20)
3:08.000 nether_portal_active V demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps, portal_summons(3), quick_navigation(3), archive_of_the_titans(20)
3:09.253 nether_portal_active S hand_of_guldan Fluffy_Pillow 99253.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation(3), archive_of_the_titans(20)
3:10.507 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:12.177 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:12.177 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, portal_summons(4), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:12.177 nether_portal_active V demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, portal_summons(4), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:13.232 nether_portal_active P summon_vilefiend Fluffy_Pillow 97060.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, portal_summons(4), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:14.637 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 98465.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse
3:15.684 build_a_shard K shadow_bolt Fluffy_Pillow 99512.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(6), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse
3:17.082 nether_portal_active S hand_of_guldan Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(6), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(2)
3:17.972 build_a_shard K shadow_bolt Fluffy_Pillow 98896.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.157 nether_portal_active S hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.056 build_a_shard K shadow_bolt Fluffy_Pillow 98904.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.259 nether_portal_active S hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse(3)
3:22.143 build_a_shard K shadow_bolt Fluffy_Pillow 98889.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.324 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.688 build_a_shard K shadow_bolt Fluffy_Pillow 97368.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(4)
3:26.023 default H hand_of_guldan Fluffy_Pillow 96703.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.035 default I demonbolt Fluffy_Pillow 97715.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(10), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.004 default I demonbolt Fluffy_Pillow 96684.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(10), vilefiend, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.978 default H hand_of_guldan Fluffy_Pillow 95658.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(12), vilefiend, prince_malchezaar, portal_summons(7), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(5)
3:29.926 default I demonbolt Fluffy_Pillow 96606.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(12), portal_summons(7), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(5)
3:30.880 build_a_shard K shadow_bolt Fluffy_Pillow 95560.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(10), portal_summons(7), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.154 build_a_shard K shadow_bolt Fluffy_Pillow 94834.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(11), portal_summons(7), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.443 default H hand_of_guldan Fluffy_Pillow 94123.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(6), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
3:34.514 default F call_dreadstalkers Fluffy_Pillow 95194.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(6), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
3:35.712 default I demonbolt Fluffy_Pillow 96392.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
3:36.794 default H hand_of_guldan Fluffy_Pillow 95474.0/100000: 95% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)
3:37.883 build_a_shard K shadow_bolt Fluffy_Pillow 96563.0/100000: 97% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
3:39.340 build_a_shard K shadow_bolt Fluffy_Pillow 96020.0/100000: 96% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
3:40.812 build_a_shard K shadow_bolt Fluffy_Pillow 95492.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20)
3:42.290 default H hand_of_guldan Fluffy_Pillow 94970.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20)
3:43.412 default I demonbolt Fluffy_Pillow 96092.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20)
3:44.540 build_a_shard K shadow_bolt Fluffy_Pillow 95220.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), overwhelming_power(8), archive_of_the_titans(20)
3:46.160 default H hand_of_guldan Fluffy_Pillow 94840.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), overwhelming_power(6), archive_of_the_titans(20)
3:47.390 default I demonbolt Fluffy_Pillow 96070.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(4), overwhelming_power(5), archive_of_the_titans(20)
3:48.628 default I demonbolt Fluffy_Pillow 95308.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), overwhelming_power(4), archive_of_the_titans(20)
3:49.874 default H hand_of_guldan Fluffy_Pillow 94554.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), overwhelming_power(3), archive_of_the_titans(20)
3:51.127 build_a_shard K shadow_bolt Fluffy_Pillow 95807.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), quick_navigation, overwhelming_power, archive_of_the_titans(20)
3:52.807 build_a_shard K shadow_bolt Fluffy_Pillow 95487.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(20)
3:54.497 default F call_dreadstalkers Fluffy_Pillow 95177.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:55.904 build_a_shard K shadow_bolt Fluffy_Pillow 96584.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:57.594 default I demonbolt Fluffy_Pillow 96274.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:58.852 default H hand_of_guldan Fluffy_Pillow 95532.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:00.112 default E summon_vilefiend Fluffy_Pillow 96792.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:01.791 build_a_shard K shadow_bolt Fluffy_Pillow 98471.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:03.471 default D grimoire_felguard Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:04.732 build_a_shard K shadow_bolt Fluffy_Pillow 99266.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:06.411 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:08.092 default H hand_of_guldan Fluffy_Pillow 97685.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:09.345 default I demonbolt Fluffy_Pillow 98938.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:10.599 default I demonbolt Fluffy_Pillow 98192.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps, vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:11.850 build_a_shard K shadow_bolt Fluffy_Pillow 97443.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:13.519 default H hand_of_guldan Fluffy_Pillow 97112.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:14.772 default F call_dreadstalkers Fluffy_Pillow 98365.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:16.023 default I demonbolt Fluffy_Pillow 99616.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:17.277 default H hand_of_guldan Fluffy_Pillow 98870.0/100000: 99% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:18.531 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:20.189 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:21.849 build_a_shard K shadow_bolt Fluffy_Pillow 97663.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:23.509 default H hand_of_guldan Fluffy_Pillow 97323.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:24.753 build_a_shard K shadow_bolt Fluffy_Pillow 98567.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:26.413 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:28.072 build_a_shard K shadow_bolt Fluffy_Pillow 97664.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:29.654 default H hand_of_guldan Fluffy_Pillow 97246.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:30.841 build_a_shard K shadow_bolt Fluffy_Pillow 98433.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:32.422 default I demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:33.609 default I demonbolt Fluffy_Pillow 97190.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
4:34.796 default F call_dreadstalkers Fluffy_Pillow 96377.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:35.982 default H hand_of_guldan Fluffy_Pillow 97563.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:37.171 default I demonbolt Fluffy_Pillow 98752.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:38.358 default H hand_of_guldan Fluffy_Pillow 97939.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
4:39.634 build_a_shard K shadow_bolt Fluffy_Pillow 99215.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
4:41.334 default I demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:42.610 default G summon_demonic_tyrant Fluffy_Pillow 97280.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
4:44.310 build_a_shard K shadow_bolt Fluffy_Pillow 96980.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), tyrant, archive_of_the_titans(20)
4:46.009 build_a_shard K shadow_bolt Fluffy_Pillow 96679.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), tyrant, quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:47.475 default E summon_vilefiend Fluffy_Pillow 96145.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), tyrant, quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
4:48.947 default H hand_of_guldan Fluffy_Pillow 97617.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
4:50.058 build_a_shard K shadow_bolt Fluffy_Pillow 98728.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
4:51.553 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:53.017 build_a_shard K shadow_bolt Fluffy_Pillow 97468.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
4:54.497 build_a_shard K shadow_bolt Fluffy_Pillow 96948.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
4:55.984 default F call_dreadstalkers Fluffy_Pillow 96435.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
4:57.479 default H hand_of_guldan Fluffy_Pillow 97930.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
4:58.615 build_a_shard K shadow_bolt Fluffy_Pillow 99066.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(18), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_GF_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=imp

DStr_ID_Felguard : 17478 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17478.5 17478.5 15.3 / 0.088% 2186.0 / 12.5% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
948.2 939.7 Mana 0.00% 47.6 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_ID_Felguard 17478
Demonbolt 1312 7.5% 46.3 5.91sec 8510 7485 Direct 47.1 7110 14219 8361 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.28 47.10 0.00 0.00 1.1369 0.0000 393827.42 393827.42 0.00 7484.79 7484.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.81 82.40% 7109.93 6520 8308 7111.14 6891 7336 275953 275953 0.00
crit 8.29 17.60% 14219.26 13040 16616 14222.82 13330 16616 117874 117874 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1072 6.1% 61.7 4.80sec 5212 4733 Direct 61.5 4437 8881 5224 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.68 61.54 0.00 0.00 1.1011 0.0000 321470.21 321470.21 0.00 4733.21 4733.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.65 82.30% 4436.82 1634 5979 4430.36 3988 4851 224724 224724 0.00
crit 10.89 17.70% 8880.54 3267 11958 8873.34 4893 10867 96746 96746 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 142 (203) 0.8% (1.2%) 7.3 36.88sec 8285 0 Direct 7.3 4925 9849 5806 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 7.34 0.00 0.00 0.0000 0.0000 42603.54 42603.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.03 82.11% 4924.62 4925 4925 4919.70 0 4925 29673 29673 0.00
crit 1.31 17.89% 9849.24 9849 9849 7287.93 0 9849 12931 12931 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 61 0.3% 7.3 36.88sec 2479 0 Direct 7.3 2111 4221 2479 17.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 7.34 0.00 0.00 0.0000 0.0000 18193.22 18193.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.06 82.53% 2110.55 2111 2111 2108.44 0 2111 12782 12782 0.00
crit 1.28 17.47% 4221.10 4221 4221 3079.49 0 4221 5411 5411 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1278 7.3% 91.4 3.21sec 4193 2811 Direct 90.7 3590 7179 4222 17.6%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.38 90.73 0.00 0.00 1.4914 0.0000 383110.64 383110.64 0.00 2811.26 2811.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.75 82.39% 3590.11 3335 4297 3590.68 3540 3658 268366 268366 0.00
crit 15.98 17.61% 7179.44 6670 8595 7180.36 6922 7542 114745 114745 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 290 1.7% 7.3 37.11sec 11884 0 Direct 7.2 10240 20481 12049 17.7%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 7.23 0.00 0.00 0.0000 0.0000 87106.22 87106.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 82.33% 10240.44 10240 10240 10232.25 0 10240 60947 60947 0.00
crit 1.28 17.67% 20480.88 20481 20481 14781.96 0 20481 26159 26159 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3735 / 3735
(demonic_strength_) Felstorm 796 4.6% 5.4 60.72sec 43946 11466 Periodic 32.3 6258 12529 7369 17.7% 6.9%

Stats details: demonic_strength_felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 0.00 32.35 32.35 3.8330 0.6427 238368.21 340775.98 30.05 11465.52 11465.52
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.6 82.30% 6258.49 5816 7641 6255.74 6059 6527 166614 238195 30.05
crit 5.7 17.70% 12528.95 11633 15282 12490.64 0 14554 71754 102581 29.96
 
 

Action details: demonic_strength_felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Felstorm 367 2.1% 10.2 30.59sec 10836 2863 Periodic 60.6 1545 3090 1818 17.7% 12.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.17 0.00 60.61 60.61 3.7845 0.6350 110199.17 157542.95 30.05 2863.21 2863.21
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.9 82.33% 1545.30 1428 1910 1545.31 1519 1586 77111 110239 30.05
crit 10.7 17.67% 3089.78 2856 3820 3089.70 2922 3376 33089 47304 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 969 5.5% 53.3 5.53sec 5451 5426 Direct 53.3 4633 9266 5450 17.6%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.26 53.26 0.00 0.00 1.0045 0.0000 290279.58 414989.52 30.05 5426.19 5426.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.86 82.36% 4633.29 4179 5592 4634.28 4486 4784 203226 290536 30.05
crit 9.39 17.64% 9266.28 8359 11183 9268.55 8436 10614 87053 124453 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1603 9.2% 161.2 1.82sec 2981 2022 Direct 161.2 2533 5064 2981 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.20 161.20 0.00 0.00 1.4743 0.0000 480519.29 686960.03 30.05 2021.89 2021.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.68 82.31% 2533.09 2284 3056 2533.60 2492 2583 336095 480488 30.05
crit 28.52 17.69% 5063.64 4569 6113 5064.92 4795 5457 144425 206472 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - illidari_satyr 1254 / 192
melee 412 0.4% 48.0 2.67sec 387 326 Direct 48.0 329 659 387 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.05 48.05 0.00 0.00 1.1893 0.0000 18609.05 26603.87 30.05 325.66 325.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.58 82.38% 329.30 281 376 328.97 285 373 13034 18633 30.05
crit 8.47 17.62% 658.59 562 753 649.07 0 753 5575 7971 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 206 0.2% 48.0 2.67sec 194 154 Direct 48.0 165 329 194 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.05 48.05 0.00 0.00 1.2595 0.0000 9316.62 13319.23 30.05 153.96 153.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.51 82.24% 164.63 141 188 164.47 142 186 6505 9299 30.05
crit 8.53 17.76% 329.47 281 376 324.61 0 376 2812 4020 29.63
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 636 0.6% 10.4 12.69sec 2793 2793 Direct 10.4 2372 4747 2793 17.7%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.36 10.36 0.00 0.00 1.0000 0.0000 28938.25 28938.25 0.00 2793.00 2793.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.53 82.28% 2372.25 2026 2711 2364.85 0 2646 20225 20225 0.00
crit 1.84 17.72% 4746.92 4053 5422 3721.65 0 5422 8713 8713 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vicious_hellhound 1040 / 156
Demon Fangs 643 0.5% 10.3 12.93sec 2795 2795 Direct 10.3 2371 4738 2795 17.9%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.27 10.27 0.00 0.00 1.0000 0.0000 28709.45 28709.45 0.00 2794.65 2794.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.43 82.10% 2370.94 2026 2711 2366.56 0 2711 19998 19998 0.00
crit 1.84 17.90% 4737.93 4053 5422 3718.27 0 5422 8711 8711 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 396 0.3% 90.4 1.43sec 194 320 Direct 90.4 165 330 194 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.43 90.43 0.00 0.00 0.6074 0.0000 17553.52 25094.86 30.05 319.59 319.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.46 82.34% 165.00 141 188 164.79 142 184 12286 17564 30.05
crit 15.97 17.66% 329.93 281 376 329.02 0 376 5268 7531 30.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - vilefiend 3122 / 1555
Bile Spit 1095 3.1% 6.8 47.19sec 23923 0 Direct 6.8 8825 17660 10370 17.5%  
Periodic 33.3 2779 0 2779 0.0% 22.2%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 6.81 33.32 33.32 0.0000 2.0000 163204.05 163204.05 0.00 2449.15 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.62 82.50% 8825.07 8474 10104 8825.67 8646 9445 49575 49575 0.00
crit 1.19 17.50% 17659.93 16947 20207 12733.28 0 20207 21037 21037 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.3 100.00% 2778.97 2502 3310 2779.28 2622 2868 92592 92592 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.1% 30.0 9.82sec 3648 3648 Direct 30.0 3101 6200 3648 17.7%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.02 30.02 0.00 0.00 1.0000 0.0000 109492.64 156532.87 30.05 3647.81 3647.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.72 82.35% 3100.65 2737 3621 3101.40 2929 3235 76640 109566 30.05
crit 5.30 17.65% 6199.87 5474 7243 6176.27 0 7243 32853 46967 29.93
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1294 3.7% 107.6 2.71sec 1795 1339 Direct 107.6 1525 3049 1795 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.64 107.64 0.00 0.00 1.3399 0.0000 193168.56 276157.66 30.05 1339.36 1339.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.59 82.30% 1524.91 1337 1775 1525.25 1455 1569 135094 193133 30.05
crit 19.05 17.70% 3049.06 2673 3550 3049.65 2805 3282 58075 83025 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - shivarra 1912 / 288
melee 824 0.7% 47.5 2.81sec 776 653 Direct 47.5 659 1317 776 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.45 47.45 0.00 0.00 1.1879 0.0000 36805.67 52618.12 30.05 652.96 652.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.03 82.25% 658.76 562 753 657.86 569 753 25710 36756 30.05
crit 8.42 17.75% 1317.20 1125 1505 1302.05 0 1505 11095 15862 29.74
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 411 0.4% 47.5 2.81sec 387 308 Direct 47.5 329 659 387 17.5%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.45 47.45 0.00 0.00 1.2579 0.0000 18366.13 26256.59 30.05 307.69 307.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.14 82.49% 329.35 281 376 328.91 285 376 12892 18431 30.05
crit 8.31 17.51% 658.89 562 753 650.63 0 753 5474 7826 29.70
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (102) 0.0% (0.6%) 0.0 0.00sec 0 3923

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3922.77 3922.77
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 169 0.1% 7.7 18.52sec 982 0 Direct 7.7 835 1669 982 17.7%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.74 7.74 0.00 0.00 0.0000 0.0000 7597.78 10861.94 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 82.30% 834.52 717 959 831.72 0 959 5313 7596 29.97
crit 1.37 17.70% 1668.65 1434 1919 1173.71 0 1919 2285 3266 21.13
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 169 0.1% 7.7 18.52sec 980 0 Direct 7.7 834 1670 980 17.4%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.74 7.74 0.00 0.00 0.0000 0.0000 7578.63 10834.56 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.39 82.61% 834.41 717 959 831.12 0 959 5332 7623 29.94
crit 1.35 17.39% 1669.73 1434 1919 1166.07 0 1919 2246 3211 21.00
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 169 0.1% 7.7 18.52sec 981 0 Direct 7.7 835 1668 981 17.6%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.74 7.74 0.00 0.00 0.0000 0.0000 7590.43 10851.44 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 82.41% 834.62 717 959 832.00 0 959 5321 7606 29.97
crit 1.36 17.59% 1667.72 1434 1919 1180.09 0 1919 2270 3245 21.26
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 169 0.1% 7.7 18.52sec 979 0 Direct 7.7 834 1669 979 17.3%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.74 7.74 0.00 0.00 0.0000 0.0000 7575.79 10830.50 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.39 82.65% 834.44 717 959 831.82 0 959 5335 7627 29.97
crit 1.34 17.35% 1669.42 1434 1919 1179.61 0 1919 2241 3203 21.24
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - dreadstalker 3373 / 2220
Dreadbite 1068 4.0% 29.0 21.06sec 7271 0 Direct 29.0 6175 12354 7271 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.96 28.96 0.00 0.00 0.0000 0.0000 210542.25 210542.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.82 82.26% 6175.17 5711 7613 6175.69 5977 6361 147093 147093 0.00
crit 5.14 17.74% 12354.33 11423 15227 12292.51 0 15227 63449 63449 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2306 8.7% 311.3 1.90sec 1462 1106 Direct 311.3 1242 2484 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.29 311.29 0.00 0.00 1.3213 0.0000 455047.54 650545.10 30.05 1106.35 1106.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.23 82.31% 1242.24 1105 1473 1242.41 1223 1259 318296 455042 30.05
crit 55.06 17.69% 2483.66 2211 2947 2484.09 2383 2608 136752 195503 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 3085 / 3004
Fel Firebolt 3085 17.2% 1201.4 0.24sec 750 508 Direct 1196.5 640 1280 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1201.42 1196.52 0.00 0.00 1.4753 0.0000 900667.81 900667.81 0.00 508.14 508.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 985.14 82.33% 639.71 569 761 639.79 630 650 630212 630212 0.00
crit 211.37 17.67% 1279.52 1138 1523 1279.70 1249 1321 270456 270456 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - urzul 1315 / 198
Many Faced Bite 494 0.4% 10.6 12.49sec 2090 2090 Direct 10.6 1776 3553 2090 17.7%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.57 10.57 0.00 0.00 1.0001 0.0000 22099.05 31593.24 30.05 2089.94 2089.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.71 82.35% 1776.29 1519 2032 1771.00 0 2032 15466 22111 29.97
crit 1.87 17.65% 3553.43 3037 4064 2820.15 0 4064 6633 9482 23.84
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 822 0.7% 47.3 2.72sec 775 653 Direct 47.3 659 1318 775 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.29 47.29 0.00 0.00 1.1874 0.0000 36671.09 52425.72 30.05 653.09 653.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.92 82.31% 658.91 562 753 658.35 569 739 25647 36665 30.05
crit 8.37 17.69% 1317.69 1125 1505 1296.22 0 1505 11024 15760 29.58
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - demonic_tyrant 4665 / 819
Demonfire 4665 4.7% 37.6 6.88sec 6515 4892 Direct 37.6 5548 11096 6528 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.63 37.55 0.00 0.00 1.3318 0.0000 245156.14 245156.14 0.00 4892.07 4892.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.92 82.33% 5548.48 5029 5917 5551.68 5446 5666 171545 171545 0.00
crit 6.63 17.67% 11096.11 10059 11834 11092.00 0 11834 73611 73611 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1693 / 255
melee 821 0.7% 47.1 2.79sec 776 654 Direct 47.1 659 1318 776 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.11 47.11 0.00 0.00 1.1874 0.0000 36556.97 52262.58 30.05 653.51 653.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.75 82.24% 658.92 562 753 658.31 569 739 25530 36498 30.05
crit 8.37 17.76% 1317.98 1125 1505 1297.59 0 1505 11027 15764 29.59
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 410 0.3% 47.1 2.79sec 388 308 Direct 47.1 329 659 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.11 47.11 0.00 0.00 1.2574 0.0000 18268.14 26116.50 30.05 308.40 308.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.77 82.30% 329.49 281 376 329.22 285 369 12775 18264 30.05
crit 8.34 17.70% 658.73 562 753 649.31 0 753 5493 7853 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 462 0.4% 9.9 13.66sec 2093 2093 Direct 9.9 1778 3553 2093 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.91 9.91 0.00 0.00 1.0000 0.0000 20734.48 29642.43 30.05 2092.70 2092.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.15 82.28% 1778.12 1519 2032 1773.87 0 2032 14495 20722 29.97
crit 1.76 17.72% 3553.08 3037 4064 2761.11 0 4064 6240 8920 23.34
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1781 / 269
Double Breath 0 (147) 0.0% (0.8%) 0.0 0.00sec 0 7306

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7305.57 7305.57
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 485 0.4% 7.8 17.59sec 2787 0 Direct 7.8 2363 4731 2787 17.9%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.81 7.81 0.00 0.00 0.0000 0.0000 21778.59 21778.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 82.08% 2363.16 2026 2711 2357.40 0 2711 15156 15156 0.00
crit 1.40 17.92% 4731.15 4053 5422 3409.24 0 5422 6623 6623 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 483 0.4% 7.8 17.59sec 2774 0 Direct 7.8 2364 4721 2774 17.4%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.81 7.81 0.00 0.00 0.0000 0.0000 21674.93 21674.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.45 82.61% 2364.23 2026 2711 2357.09 0 2711 15259 15259 0.00
crit 1.36 17.39% 4721.18 4053 5422 3325.45 0 5422 6416 6416 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 813 0.7% 46.9 2.77sec 775 651 Direct 46.9 659 1317 775 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.93 46.93 0.00 0.00 1.1907 0.0000 36364.53 51987.46 30.05 650.82 650.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.64 82.34% 658.64 562 753 658.04 569 741 25451 36385 30.05
crit 8.29 17.66% 1317.07 1125 1505 1297.08 0 1505 10914 15602 29.62
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - darkhound 1285 / 193
Fel Bite 464 0.4% 9.9 13.72sec 2091 2091 Direct 9.9 1778 3552 2091 17.7%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.92 9.92 0.00 0.00 1.0001 0.0000 20754.37 29670.86 30.05 2091.33 2091.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.17 82.33% 1777.81 1519 2032 1773.98 0 2008 14526 20766 29.98
crit 1.75 17.67% 3551.69 3037 4064 2799.17 0 4064 6229 8905 23.68
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 821 0.7% 47.1 2.81sec 774 652 Direct 47.1 659 1318 774 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.14 47.14 0.00 0.00 1.1877 0.0000 36500.75 52182.21 30.05 651.92 651.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.87 82.45% 658.58 562 753 657.81 0 744 25600 36598 30.04
crit 8.27 17.55% 1317.92 1125 1505 1302.01 0 1505 10901 15584 29.71
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - bilescourge 3822 / 569
Toxic Bile 3822 3.2% 60.2 2.06sec 2802 2979 Direct 60.1 2380 4761 2803 17.8%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.15 60.13 0.00 0.00 0.9406 0.0000 168551.67 168551.67 0.00 2979.21 2979.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.43 82.21% 2379.52 2026 2711 2374.50 0 2659 117614 117614 0.00
crit 10.70 17.79% 4760.65 4053 5422 4713.90 0 5422 50937 50937 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - eye_of_guldan 983 / 81
Eye of Gul'dan 983 0.5% 27.6 5.44sec 868 1140 Periodic 60.1 398 0 398 0.0% 58.8%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.58 0.00 60.11 60.11 0.7617 2.9363 23941.17 23941.17 0.00 121.22 1139.73
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.1 100.00% 398.31 182 484 396.97 353 430 23941 23941 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4556 / 394
melee 3041 1.5% 21.1 1.59sec 3681 3106 Direct 21.1 3123 6241 3681 17.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.11 21.11 0.00 0.00 1.1853 0.0000 77725.43 111117.83 30.05 3105.66 3105.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.33 82.09% 3122.95 2665 3566 3114.24 2678 3509 54129 77384 30.05
crit 3.78 17.91% 6241.35 5330 7131 6020.99 0 7131 23596 33733 29.01
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1516 0.7% 21.1 1.59sec 1834 1461 Direct 21.1 1562 3116 1834 17.5%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.11 21.11 0.00 0.00 1.2555 0.0000 38724.95 55361.97 30.05 1460.93 1460.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.42 82.48% 1562.02 1333 1783 1557.92 1347 1755 27202 38889 30.05
crit 3.70 17.52% 3115.54 2665 3566 2937.48 0 3566 11523 16473 28.38
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DStr_ID_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.00sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.5 21.06sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.53 0.00 0.00 0.00 1.2050 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
Demonic Strength 5.5 60.48sec

Stats details: demonic_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.2155 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demonic_strength

Static Values
  • id:267171
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
Spelldata
  • id:267171
  • name:Demonic Strength
  • school:shadow
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 183.58sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0909 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.55sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 1.5067 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 17.9 13.89sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.19sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 0.00 0.00 0.00 1.5512 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.0sec 187.0sec 6.76% 8.44% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.7 15.1 23.4sec 10.3sec 51.61% 83.20% 15.1(15.1) 0.1

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.61%

Trigger Attempt Success

  • trigger_pct:20.03%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.8 32.3 12.0sec 5.0sec 41.24% 100.00% 5.0(5.0) 0.4

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.70%
  • demonic_core_2:16.27%
  • demonic_core_3:5.58%
  • demonic_core_4:2.68%

Trigger Attempt Success

  • trigger_pct:23.74%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.57% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.5 17.6 26.8sec 10.2sec 65.80% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.43%
  • dreadstalkers_4:6.37%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.6 176.5sec 2.8sec 1.45% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.8sec 171.8sec 14.79% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.11%
  • ignition_mages_fuse_2:3.07%
  • ignition_mages_fuse_3:3.03%
  • ignition_mages_fuse_4:2.87%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 183.5sec 183.5sec 10.14% 18.33% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 66.6sec 36.3sec 44.37% 0.00% 3.0(41.3) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.31%
  • overwhelming_power_2:1.34%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.41%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.56%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.65%
  • overwhelming_power_11:1.69%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.83%
  • overwhelming_power_15:1.88%
  • overwhelming_power_16:1.94%
  • overwhelming_power_17:1.99%
  • overwhelming_power_18:2.05%
  • overwhelming_power_19:2.11%
  • overwhelming_power_20:2.17%
  • overwhelming_power_21:2.23%
  • overwhelming_power_22:2.29%
  • overwhelming_power_23:2.36%
  • overwhelming_power_24:2.42%
  • overwhelming_power_25:1.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.4 183.5sec 13.7sec 19.47% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.61%
  • portal_summons_2:0.78%
  • portal_summons_3:1.20%
  • portal_summons_4:1.52%
  • portal_summons_5:1.88%
  • portal_summons_6:1.85%
  • portal_summons_7:3.89%
  • portal_summons_8:5.64%
  • portal_summons_9:1.09%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 158.3sec 102.9sec 1.47% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.49%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.3 52.4sec 10.4sec 67.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.58%
  • quick_navigation_2:17.17%
  • quick_navigation_3:16.61%
  • quick_navigation_4:16.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.4sec 52.4sec 17.43% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.4sec 79.7sec 16.98% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:16.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.57% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.57%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.84% 0.00% 0.0(0.0) 6.3

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.84%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 184.1 130.1sec 0.0sec 97.37% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.84%
  • wild_imps_2:2.08%
  • wild_imps_3:10.89%
  • wild_imps_4:20.90%
  • wild_imps_5:8.02%
  • wild_imps_6:14.92%
  • wild_imps_7:17.78%
  • wild_imps_8:5.13%
  • wild_imps_9:3.25%
  • wild_imps_10:3.33%
  • wild_imps_11:4.32%
  • wild_imps_12:1.86%
  • wild_imps_13:1.22%
  • wild_imps_14:1.24%
  • wild_imps_15:0.37%
  • wild_imps_16:0.14%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
felguard: Demonic Strength 5.5 0.0 60.4sec 60.5sec 10.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard_felguard
  • cooldown name:buff_demonic_strength
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_strength_1:10.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267171
  • name:Demonic Strength
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.9 13.8sec
one_shard_hog 9.3 21.9sec
two_shard_hog 4.0 51.5sec
three_shard_hog 48.4 5.8sec
portal_summon 15.4 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_ID_Felguard
call_dreadstalkers Soul Shard 14.5 17.0 1.2 1.2 0.0
demonbolt Mana 47.3 94560.1 2000.0 2043.2 4.2
hand_of_guldan Soul Shard 61.7 162.4 2.6 2.6 1979.3
shadow_bolt Mana 91.4 182751.1 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7148.9 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
demonic_strength_felstorm Energy 5.4 325.4 60.0 60.0 732.5
felstorm Energy 10.2 610.2 60.0 60.0 180.6
legion_strike Energy 53.3 3195.4 60.0 60.0 90.8
pet - wild_imp
fel_firebolt Energy 1201.4 18239.1 15.2 15.2 49.4
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 47.28 94.41 (50.82%) 2.00 0.15 0.16%
shadow_bolt Soul Shard 91.38 91.37 (49.18%) 1.00 0.00 0.00%
mana_regen Mana 555.55 281916.24 (100.00%) 507.46 17551.16 5.86%
pet - felguard
energy_regen Energy 379.09 3990.55 (100.00%) 10.53 18.58 0.46%
pet - demonic_tyrant
energy_regen Energy 37.63 0.00 (0.00%) 0.00 759.54 100.00%
pet - bilescourge
energy_regen Energy 12.14 0.00 (0.00%) 0.00 167.51 100.00%
pet - bilescourge
energy_regen Energy 12.92 0.00 (0.00%) 0.00 179.24 100.00%
pet - bilescourge
energy_regen Energy 11.97 0.00 (0.00%) 0.00 164.65 100.00%
pet - bilescourge
energy_regen Energy 14.91 0.00 (0.00%) 0.00 206.22 100.00%
pet - bilescourge
energy_regen Energy 6.40 0.00 (0.00%) 0.00 88.59 100.00%
pet - bilescourge
energy_regen Energy 0.39 0.00 (0.00%) 0.00 5.49 100.00%
Resource RPS-Gain RPS-Loss
Mana 939.69 948.17
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97452.61 92827.00 100000.00
Soul Shard 2.54 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.5%

Statistics & Data Analysis

Fight Length
Sample Data T22_Warlock_Demonology Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data T22_Warlock_Demonology Damage Per Second
Count 4999
Mean 17478.46
Minimum 15836.90
Maximum 19587.08
Spread ( max - min ) 3750.18
Range [ ( max - min ) / 2 * 100% ] 10.73%
Standard Deviation 552.3117
5th Percentile 16640.46
95th Percentile 18463.18
( 95th Percentile - 5th Percentile ) 1822.72
Mean Distribution
Standard Deviation 7.8116
95.00% Confidence Intervall ( 17463.15 - 17493.77 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3836
0.1 Scale Factor Error with Delta=300 2605
0.05 Scale Factor Error with Delta=300 10417
0.01 Scale Factor Error with Delta=300 260407
Priority Target DPS
Sample Data T22_Warlock_Demonology Priority Target Damage Per Second
Count 4999
Mean 17478.46
Minimum 15836.90
Maximum 19587.08
Spread ( max - min ) 3750.18
Range [ ( max - min ) / 2 * 100% ] 10.73%
Standard Deviation 552.3117
5th Percentile 16640.46
95th Percentile 18463.18
( 95th Percentile - 5th Percentile ) 1822.72
Mean Distribution
Standard Deviation 7.8116
95.00% Confidence Intervall ( 17463.15 - 17493.77 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3836
0.1 Scale Factor Error with Delta=300 2605
0.05 Scale Factor Error with Delta=300 10417
0.01 Scale Factor Error with Delta=300 260407
DPS(e)
Sample Data T22_Warlock_Demonology Damage Per Second (Effective)
Count 4999
Mean 17478.46
Minimum 15836.90
Maximum 19587.08
Spread ( max - min ) 3750.18
Range [ ( max - min ) / 2 * 100% ] 10.73%
Damage
Sample Data T22_Warlock_Demonology Damage
Count 4999
Mean 1246311.24
Minimum 864151.30
Maximum 1669792.20
Spread ( max - min ) 805640.89
Range [ ( max - min ) / 2 * 100% ] 32.32%
DTPS
Sample Data T22_Warlock_Demonology Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Warlock_Demonology Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Warlock_Demonology Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Warlock_Demonology Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Warlock_Demonology Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Warlock_Demonology Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Warlock_DemonologyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Warlock_Demonology Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.36 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
B 5.47 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
C 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
D 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.85 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.52 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.98 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 42.45 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 91.87 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
O 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
P 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Q 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
R 14.57 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
S 1.97 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
T 0.03 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
U 3.83 demonbolt,if=buff.demonic_core.up
V 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
W 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
X 1.02 call_dreadstalkers
Y 0.54 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Z 1.80 hand_of_guldan,if=soul_shard>=5
a 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467BWOPRKRS9AKRKRKRKRKRKRKKKKKFHIHKKKHIIHKKHIIHKKKKFKEHIHKKKHBIIKHFIHIIHKKHKKKKKHKFIKHEIHG8KKKKKHFKKKHIIBHIHIIHIIHIFHKKKIHKEIHIHIIKFHKIHIKKZKKKZKKXYKKKBKKWRRUOKPRS9AURKRKRKKKHKKKFIHIHIIHIHIIHIHKKKFEKKBKHKKKHIIKHKFKHKKKHKKKHKIIHFIKEHKGIHKKKKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 default B demonic_strength Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.277 nether_portal_building W nether_portal Fluffy_Pillow 99277.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.260 nether_portal_active O summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.568 nether_portal_active P call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:04.877 nether_portal_active R hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:05.858 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:07.167 nether_portal_active R hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:08.150 nether_portal_active S summon_demonic_tyrant Fluffy_Pillow 98988.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect
0:09.457 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect
0:09.457 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.457 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.557 nether_portal_active R hand_of_guldan Fluffy_Pillow 97103.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.385 build_a_shard K shadow_bolt Fluffy_Pillow 97931.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.485 nether_portal_active R hand_of_guldan Fluffy_Pillow 97031.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(25), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.238 build_a_shard K shadow_bolt Fluffy_Pillow 97784.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), overwhelming_power(24), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:14.200 nether_portal_active R hand_of_guldan Fluffy_Pillow 96746.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), overwhelming_power(23), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.954 build_a_shard K shadow_bolt Fluffy_Pillow 97500.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(23), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.892 nether_portal_active R hand_of_guldan Fluffy_Pillow 96438.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(22), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.646 build_a_shard K shadow_bolt Fluffy_Pillow 97192.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(21), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:17.595 nether_portal_active R hand_of_guldan Fluffy_Pillow 96141.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(20), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.348 build_a_shard K shadow_bolt Fluffy_Pillow 96894.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(19), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.281 nether_portal_active R hand_of_guldan Fluffy_Pillow 95827.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(25), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.036 build_a_shard K shadow_bolt Fluffy_Pillow 96582.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(24), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:21.083 build_a_shard K shadow_bolt Fluffy_Pillow 95629.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(23), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:22.134 build_a_shard K shadow_bolt Fluffy_Pillow 94680.0/100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(25), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.145 build_a_shard K shadow_bolt Fluffy_Pillow 93691.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(24), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.163 build_a_shard K shadow_bolt Fluffy_Pillow 92709.0/100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(23), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.186 default F call_dreadstalkers Fluffy_Pillow 91732.0/100000: 92% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(8), overwhelming_power(22), archive_of_the_titans(6), ignition_mages_fuse(4)
0:25.956 default H hand_of_guldan Fluffy_Pillow 92502.0/100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), overwhelming_power(22), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.712 default I demonbolt Fluffy_Pillow 93258.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation, overwhelming_power(21), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.466 default H hand_of_guldan Fluffy_Pillow 92012.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation, overwhelming_power(20), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.221 build_a_shard K shadow_bolt Fluffy_Pillow 92767.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(6), ignition_mages_fuse(5)
0:29.199 build_a_shard K shadow_bolt Fluffy_Pillow 91745.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(6), ignition_mages_fuse(5)
0:30.181 build_a_shard K shadow_bolt Fluffy_Pillow 90727.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(23), archive_of_the_titans(7)
0:31.315 default H hand_of_guldan Fluffy_Pillow 89861.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(22), archive_of_the_titans(7)
0:32.168 default I demonbolt Fluffy_Pillow 90714.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(21), archive_of_the_titans(7)
0:33.028 default I demonbolt Fluffy_Pillow 89574.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(20), archive_of_the_titans(7)
0:33.893 default H hand_of_guldan Fluffy_Pillow 88439.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(7)
0:34.757 build_a_shard K shadow_bolt Fluffy_Pillow 89303.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(19), archive_of_the_titans(7)
0:35.909 build_a_shard K shadow_bolt Fluffy_Pillow 88455.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(8)
0:37.067 default H hand_of_guldan Fluffy_Pillow 87613.0/100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(8)
0:37.947 default I demonbolt Fluffy_Pillow 88493.0/100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(8)
0:38.827 default I demonbolt Fluffy_Pillow 87373.0/100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(8)
0:39.711 default H hand_of_guldan Fluffy_Pillow 86257.0/100000: 86% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(8)
0:40.599 build_a_shard K shadow_bolt Fluffy_Pillow 87145.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(9)
0:41.789 build_a_shard K shadow_bolt Fluffy_Pillow 86335.0/100000: 86% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), quick_navigation(3), overwhelming_power(12), archive_of_the_titans(9)
0:43.342 build_a_shard K shadow_bolt Fluffy_Pillow 85888.0/100000: 86% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(10), archive_of_the_titans(9)
0:44.915 build_a_shard K shadow_bolt Fluffy_Pillow 85461.0/100000: 85% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(9), archive_of_the_titans(9)
0:46.497 default F call_dreadstalkers Fluffy_Pillow 85043.0/100000: 85% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(10)
0:47.697 build_a_shard K shadow_bolt Fluffy_Pillow 86243.0/100000: 86% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(6), archive_of_the_titans(10)
0:49.307 default E summon_vilefiend Fluffy_Pillow 85853.0/100000: 86% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(4), archive_of_the_titans(10)
0:50.936 default H hand_of_guldan Fluffy_Pillow 87482.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps, dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(3), archive_of_the_titans(11)
0:52.166 default I demonbolt Fluffy_Pillow 88712.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps, dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power, archive_of_the_titans(11)
0:53.409 default H hand_of_guldan Fluffy_Pillow 87955.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(11)
0:54.662 build_a_shard K shadow_bolt Fluffy_Pillow 89208.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(11)
0:56.332 build_a_shard K shadow_bolt Fluffy_Pillow 88878.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(12)
0:57.992 build_a_shard K shadow_bolt Fluffy_Pillow 88538.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(12)
0:59.652 default H hand_of_guldan Fluffy_Pillow 88198.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(12)
1:00.897 default B demonic_strength Fluffy_Pillow 89443.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:02.143 default I demonbolt Fluffy_Pillow 90689.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:03.388 default I demonbolt Fluffy_Pillow 89934.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(7), vilefiend, quick_navigation_final, archive_of_the_titans(13)
1:04.576 build_a_shard K shadow_bolt Fluffy_Pillow 89122.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation_final, archive_of_the_titans(13)
1:06.159 default H hand_of_guldan Fluffy_Pillow 88705.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(14)
1:07.346 default F call_dreadstalkers Fluffy_Pillow 89892.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(14)
1:08.533 default I demonbolt Fluffy_Pillow 91079.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(14)
1:09.721 default H hand_of_guldan Fluffy_Pillow 90267.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(14)
1:10.909 default I demonbolt Fluffy_Pillow 91455.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:12.097 default I demonbolt Fluffy_Pillow 90643.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:13.282 default H hand_of_guldan Fluffy_Pillow 89828.0/100000: 90% mana | 4.0/5: 80% soul_shard wild_imps(7), dreadstalkers(2), archive_of_the_titans(15)
1:14.557 build_a_shard K shadow_bolt Fluffy_Pillow 91103.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(7), dreadstalkers(2), archive_of_the_titans(15)
1:16.258 build_a_shard K shadow_bolt Fluffy_Pillow 90804.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(9), dreadstalkers(2), archive_of_the_titans(16)
1:17.958 default H hand_of_guldan Fluffy_Pillow 90504.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(16)
1:19.235 build_a_shard K shadow_bolt Fluffy_Pillow 91781.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(16)
1:20.937 build_a_shard K shadow_bolt Fluffy_Pillow 91483.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(17)
1:22.639 build_a_shard K shadow_bolt Fluffy_Pillow 91185.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(17)
1:24.340 build_a_shard K shadow_bolt Fluffy_Pillow 90886.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(17)
1:26.032 build_a_shard K shadow_bolt Fluffy_Pillow 90578.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(18)
1:27.723 default H hand_of_guldan Fluffy_Pillow 90269.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(18)
1:28.992 build_a_shard K shadow_bolt Fluffy_Pillow 91538.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(18)
1:30.681 default F call_dreadstalkers Fluffy_Pillow 91227.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(19)
1:31.951 default I demonbolt Fluffy_Pillow 92497.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:33.221 build_a_shard K shadow_bolt Fluffy_Pillow 91767.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:34.910 default H hand_of_guldan Fluffy_Pillow 91456.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:36.179 default E summon_vilefiend Fluffy_Pillow 92725.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:37.858 default I demonbolt Fluffy_Pillow 94404.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:39.119 default H hand_of_guldan Fluffy_Pillow 93665.0/100000: 94% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:40.379 default G summon_demonic_tyrant Fluffy_Pillow 94925.0/100000: 95% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:42.060 default 8 potion Fluffy_Pillow 94606.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:42.060 build_a_shard K shadow_bolt Fluffy_Pillow 94606.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:43.741 build_a_shard K shadow_bolt Fluffy_Pillow 94287.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:45.412 build_a_shard K shadow_bolt Fluffy_Pillow 93958.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:47.081 build_a_shard K shadow_bolt Fluffy_Pillow 93627.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:48.748 build_a_shard K shadow_bolt Fluffy_Pillow 93294.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:50.409 default H hand_of_guldan Fluffy_Pillow 92955.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:51.491 default F call_dreadstalkers Fluffy_Pillow 94037.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
1:52.939 build_a_shard K shadow_bolt Fluffy_Pillow 95485.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(10), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect
1:54.392 build_a_shard K shadow_bolt Fluffy_Pillow 94938.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
1:55.864 build_a_shard K shadow_bolt Fluffy_Pillow 94410.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
1:57.344 default H hand_of_guldan Fluffy_Pillow 93890.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
1:58.468 default I demonbolt Fluffy_Pillow 95014.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
1:59.597 default I demonbolt Fluffy_Pillow 94143.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
2:00.732 default B demonic_strength Fluffy_Pillow 93278.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(13), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
2:02.039 default H hand_of_guldan Fluffy_Pillow 94585.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
2:03.194 default I demonbolt Fluffy_Pillow 95740.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
2:04.355 default H hand_of_guldan Fluffy_Pillow 94901.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect
2:05.523 default I demonbolt Fluffy_Pillow 96069.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect
2:06.645 default I demonbolt Fluffy_Pillow 95191.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20), battle_potion_of_intellect
2:07.773 default H hand_of_guldan Fluffy_Pillow 94319.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20)
2:08.908 default I demonbolt Fluffy_Pillow 95454.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
2:10.049 default I demonbolt Fluffy_Pillow 94595.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
2:11.206 default H hand_of_guldan Fluffy_Pillow 93752.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(9), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
2:12.249 default I demonbolt Fluffy_Pillow 94795.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(8), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
2:13.297 default F call_dreadstalkers Fluffy_Pillow 93843.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
2:14.350 default H hand_of_guldan Fluffy_Pillow 94896.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(8), dreadstalkers(2), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:15.411 build_a_shard K shadow_bolt Fluffy_Pillow 95957.0/100000: 96% mana | 0.0/5: 0% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:16.827 build_a_shard K shadow_bolt Fluffy_Pillow 95373.0/100000: 95% mana | 1.0/5: 20% soul_shard wild_imps(8), dreadstalkers(2), overwhelming_power(19), archive_of_the_titans(20)
2:18.347 build_a_shard K shadow_bolt Fluffy_Pillow 94893.0/100000: 95% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation, overwhelming_power(17), archive_of_the_titans(20)
2:19.877 default I demonbolt Fluffy_Pillow 94423.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(16), archive_of_the_titans(20)
2:21.031 default H hand_of_guldan Fluffy_Pillow 93577.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(14), archive_of_the_titans(20)
2:22.198 build_a_shard K shadow_bolt Fluffy_Pillow 94744.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
2:23.753 default E summon_vilefiend Fluffy_Pillow 94299.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(12), archive_of_the_titans(20)
2:25.318 default I demonbolt Fluffy_Pillow 95864.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20)
2:26.505 default H hand_of_guldan Fluffy_Pillow 95051.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
2:27.701 default I demonbolt Fluffy_Pillow 96247.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20)
2:28.904 default H hand_of_guldan Fluffy_Pillow 95450.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
2:30.112 default I demonbolt Fluffy_Pillow 96658.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), overwhelming_power(5), archive_of_the_titans(20)
2:31.335 default I demonbolt Fluffy_Pillow 95881.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
2:32.565 build_a_shard K shadow_bolt Fluffy_Pillow 95111.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20)
2:34.215 default F call_dreadstalkers Fluffy_Pillow 94761.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
2:35.467 default H hand_of_guldan Fluffy_Pillow 96013.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:36.728 build_a_shard K shadow_bolt Fluffy_Pillow 97274.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:38.410 default I demonbolt Fluffy_Pillow 96956.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:39.661 default H hand_of_guldan Fluffy_Pillow 96207.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:40.914 default I demonbolt Fluffy_Pillow 97460.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
2:41.994 build_a_shard K shadow_bolt Fluffy_Pillow 96540.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
2:43.441 build_a_shard K shadow_bolt Fluffy_Pillow 95987.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
2:44.844 nether_portal_building Z hand_of_guldan Fluffy_Pillow 95390.0/100000: 95% mana | 5.0/5: 100% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:45.905 build_a_shard K shadow_bolt Fluffy_Pillow 96451.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:47.322 build_a_shard K shadow_bolt Fluffy_Pillow 95868.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:48.754 build_a_shard K shadow_bolt Fluffy_Pillow 95300.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(7), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
2:50.194 nether_portal_building Z hand_of_guldan Fluffy_Pillow 94740.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(4), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
2:51.286 build_a_shard K shadow_bolt Fluffy_Pillow 95832.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
2:52.749 build_a_shard K shadow_bolt Fluffy_Pillow 95295.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(5), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
2:54.222 nether_portal_building X call_dreadstalkers Fluffy_Pillow 94768.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(7), overwhelming_power(11), archive_of_the_titans(20)
2:55.416 nether_portal_building Y hand_of_guldan Fluffy_Pillow 95962.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), overwhelming_power(10), archive_of_the_titans(20)
2:56.619 build_a_shard K shadow_bolt Fluffy_Pillow 97165.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), overwhelming_power(9), archive_of_the_titans(20)
2:58.229 build_a_shard K shadow_bolt Fluffy_Pillow 96775.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), overwhelming_power(7), archive_of_the_titans(20)
2:59.859 build_a_shard K shadow_bolt Fluffy_Pillow 96405.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), dreadstalkers(2), overwhelming_power(6), archive_of_the_titans(20)
3:01.499 default B demonic_strength Fluffy_Pillow 96045.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(4), archive_of_the_titans(20)
3:02.737 build_a_shard K shadow_bolt Fluffy_Pillow 97283.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
3:04.399 build_a_shard K shadow_bolt Fluffy_Pillow 96945.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
3:06.068 nether_portal_building W nether_portal Fluffy_Pillow 96614.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:07.328 nether_portal_active R hand_of_guldan Fluffy_Pillow 97874.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps, portal_summons, quick_navigation(2), archive_of_the_titans(20)
3:08.588 nether_portal_active R hand_of_guldan Fluffy_Pillow 99134.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, portal_summons(2), quick_navigation(2), archive_of_the_titans(20)
3:09.849 nether_portal_active U demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps, portal_summons(3), quick_navigation(2), archive_of_the_titans(20)
3:11.109 nether_portal_active O summon_vilefiend Fluffy_Pillow 99260.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation(2), archive_of_the_titans(20)
3:12.788 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(6), vilefiend, portal_summons(4), quick_navigation(2), archive_of_the_titans(20)
3:14.467 nether_portal_active P call_dreadstalkers Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(6), vilefiend, portal_summons(4), quick_navigation(2), archive_of_the_titans(20)
3:15.729 nether_portal_active R hand_of_guldan Fluffy_Pillow 99266.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation(2), archive_of_the_titans(20)
3:16.990 nether_portal_active S summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, portal_summons(6), quick_navigation(2), archive_of_the_titans(20)
3:18.668 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(20)
3:18.668 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:18.668 nether_portal_active U demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:19.730 nether_portal_active R hand_of_guldan Fluffy_Pillow 97065.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:20.793 build_a_shard K shadow_bolt Fluffy_Pillow 98128.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:22.197 nether_portal_active R hand_of_guldan Fluffy_Pillow 97532.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:23.251 build_a_shard K shadow_bolt Fluffy_Pillow 98586.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(2)
3:24.612 nether_portal_active R hand_of_guldan Fluffy_Pillow 97947.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:25.628 build_a_shard K shadow_bolt Fluffy_Pillow 98963.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:26.980 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(3)
3:28.292 build_a_shard K shadow_bolt Fluffy_Pillow 97316.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(3)
3:29.603 default H hand_of_guldan Fluffy_Pillow 96627.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(3)
3:30.734 build_a_shard K shadow_bolt Fluffy_Pillow 97758.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.199 build_a_shard K shadow_bolt Fluffy_Pillow 97223.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(4)
3:33.662 build_a_shard K shadow_bolt Fluffy_Pillow 96686.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(4)
3:35.126 default F call_dreadstalkers Fluffy_Pillow 96150.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.191 default I demonbolt Fluffy_Pillow 97215.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:37.258 default H hand_of_guldan Fluffy_Pillow 96282.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:38.326 default I demonbolt Fluffy_Pillow 97350.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(5)
3:39.350 default H hand_of_guldan Fluffy_Pillow 96374.0/100000: 96% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:40.536 default I demonbolt Fluffy_Pillow 97560.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:41.723 default I demonbolt Fluffy_Pillow 96747.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:42.910 default H hand_of_guldan Fluffy_Pillow 95934.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:44.097 default I demonbolt Fluffy_Pillow 97121.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:45.286 default H hand_of_guldan Fluffy_Pillow 96310.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:46.473 default I demonbolt Fluffy_Pillow 97497.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(9), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
3:47.510 default I demonbolt Fluffy_Pillow 96534.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(8), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
3:48.554 default H hand_of_guldan Fluffy_Pillow 95578.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(10), overwhelming_power(23), archive_of_the_titans(20)
3:49.669 default I demonbolt Fluffy_Pillow 96693.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(8), quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
3:50.784 default H hand_of_guldan Fluffy_Pillow 95808.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(7), quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
3:51.906 build_a_shard K shadow_bolt Fluffy_Pillow 96930.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(10), quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
3:53.410 build_a_shard K shadow_bolt Fluffy_Pillow 96434.0/100000: 96% mana | 1.0/5: 20% soul_shard wild_imps(10), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
3:54.866 build_a_shard K shadow_bolt Fluffy_Pillow 95890.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(10), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
3:56.331 default F call_dreadstalkers Fluffy_Pillow 95355.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(6), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
3:57.787 default E summon_vilefiend Fluffy_Pillow 96811.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
3:59.250 build_a_shard K shadow_bolt Fluffy_Pillow 98274.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
4:00.729 build_a_shard K shadow_bolt Fluffy_Pillow 97753.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
4:02.218 default B demonic_strength Fluffy_Pillow 97242.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps, dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
4:03.346 build_a_shard K shadow_bolt Fluffy_Pillow 98370.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps, dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20)
4:04.859 default H hand_of_guldan Fluffy_Pillow 97883.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps, dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
4:06.002 build_a_shard K shadow_bolt Fluffy_Pillow 99026.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps, dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
4:07.539 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20)
4:09.085 build_a_shard K shadow_bolt Fluffy_Pillow 97550.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(12), archive_of_the_titans(20)
4:10.650 default H hand_of_guldan Fluffy_Pillow 97115.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
4:11.825 default I demonbolt Fluffy_Pillow 98290.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20)
4:13.000 default I demonbolt Fluffy_Pillow 97465.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), overwhelming_power(9), archive_of_the_titans(20)
4:14.183 build_a_shard K shadow_bolt Fluffy_Pillow 96648.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), overwhelming_power(7), archive_of_the_titans(20)
4:15.775 default H hand_of_guldan Fluffy_Pillow 96240.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
4:16.921 build_a_shard K shadow_bolt Fluffy_Pillow 97386.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
4:18.457 default F call_dreadstalkers Fluffy_Pillow 96922.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
4:19.624 build_a_shard K shadow_bolt Fluffy_Pillow 98089.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(2), archive_of_the_titans(20)
4:21.190 default H hand_of_guldan Fluffy_Pillow 97655.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:22.378 build_a_shard K shadow_bolt Fluffy_Pillow 98843.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:23.960 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:25.543 build_a_shard K shadow_bolt Fluffy_Pillow 97587.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:27.126 default H hand_of_guldan Fluffy_Pillow 97170.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:28.393 build_a_shard K shadow_bolt Fluffy_Pillow 98437.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:30.084 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:31.773 build_a_shard K shadow_bolt Fluffy_Pillow 97695.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:33.464 default H hand_of_guldan Fluffy_Pillow 97386.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:34.725 build_a_shard K shadow_bolt Fluffy_Pillow 98647.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:36.404 default I demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
4:37.657 default I demonbolt Fluffy_Pillow 97257.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(20)
4:38.909 default H hand_of_guldan Fluffy_Pillow 96509.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(20)
4:40.161 default F call_dreadstalkers Fluffy_Pillow 97761.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(20)
4:41.408 default I demonbolt Fluffy_Pillow 99008.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:42.653 build_a_shard K shadow_bolt Fluffy_Pillow 98253.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:44.311 default E summon_vilefiend Fluffy_Pillow 97911.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:45.970 default H hand_of_guldan Fluffy_Pillow 99570.0/100000: 100% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:47.216 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:48.877 default G summon_demonic_tyrant Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:50.536 default I demonbolt Fluffy_Pillow 97665.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:51.781 default H hand_of_guldan Fluffy_Pillow 96910.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:52.968 build_a_shard K shadow_bolt Fluffy_Pillow 98097.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:54.550 build_a_shard K shadow_bolt Fluffy_Pillow 97679.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:56.131 build_a_shard K shadow_bolt Fluffy_Pillow 97260.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:57.712 build_a_shard K shadow_bolt Fluffy_Pillow 96841.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:59.294 build_a_shard K shadow_bolt Fluffy_Pillow 96423.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_ID_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DStr_ID_Imp : 17034 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17033.6 17033.6 15.4 / 0.091% 2166.4 / 12.7% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
970.7 961.1 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_ID_Imp 17034
Demonbolt 1334 7.9% 47.0 5.82sec 8522 7496 Direct 47.8 7114 14231 8374 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.99 47.83 0.00 0.00 1.1369 0.0000 400485.39 400485.39 0.00 7496.22 7496.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.36 82.30% 7113.98 6520 8308 7115.77 6921 7338 280000 280000 0.00
crit 8.47 17.70% 14231.13 13040 16616 14227.99 0 15906 120486 120486 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1098 6.5% 62.9 4.72sec 5242 4748 Direct 62.7 4463 8933 5253 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.86 62.72 0.00 0.00 1.1040 0.0000 329493.43 329493.43 0.00 4747.68 4747.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.64 82.33% 4463.10 1634 5979 4457.04 4043 4815 230469 230469 0.00
crit 11.09 17.67% 8932.87 3267 11958 8924.57 5029 10879 99025 99025 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 37.34sec 8273 0 Direct 7.3 4925 9849 5794 17.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.31 0.00 0.00 0.0000 0.0000 42366.12 42366.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.02 82.34% 4924.62 4925 4925 4921.67 0 4925 29646 29646 0.00
crit 1.29 17.66% 9849.24 9849 9849 7155.92 0 9849 12720 12720 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 37.34sec 2479 0 Direct 7.3 2111 4221 2479 17.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.31 0.00 0.00 0.0000 0.0000 18122.71 18122.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.04 82.56% 2110.55 2111 2111 2109.71 0 2111 12740 12740 0.00
crit 1.28 17.44% 4221.10 4221 4221 3042.34 0 4221 5383 5383 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1316 7.7% 94.0 3.13sec 4196 2813 Direct 93.4 3593 7187 4226 17.6%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.04 93.37 0.00 0.00 1.4919 0.0000 394569.33 394569.33 0.00 2812.57 2812.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.93 82.39% 3592.97 3335 4297 3593.50 3548 3655 276415 276415 0.00
crit 16.44 17.61% 7186.90 6670 8595 7188.02 6950 7659 118155 118155 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 290 1.7% 7.3 36.21sec 11872 0 Direct 7.2 10240 20481 12023 17.4%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 7.24 0.00 0.00 0.0000 0.0000 86997.65 86997.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.98 82.59% 10240.44 10240 10240 10232.25 0 10240 61191 61191 0.00
crit 1.26 17.41% 20480.88 20481 20481 14863.90 0 20481 25807 25807 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3138 / 3138
Firebolt 3138 18.4% 103.8 2.89sec 9059 6926 Direct 103.0 7759 15522 9131 17.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.81 102.99 0.00 0.00 1.3079 0.0000 940393.29 940393.29 0.00 6926.37 6926.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.78 82.32% 7758.85 7027 9401 7759.76 7617 7917 657783 657783 0.00
crit 18.21 17.68% 15521.54 14053 18802 15523.70 14550 16739 282611 282611 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - void_terror 1789 / 273
Double Breath 0 (149) 0.0% (0.9%) 0.0 0.00sec 0 7301

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7301.18 7301.18
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 486 0.4% 7.9 17.25sec 2783 0 Direct 7.9 2365 4730 2783 17.6%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 0.0000 0.0000 22115.83 22115.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.54 82.35% 2365.46 2026 2711 2359.87 0 2711 15482 15482 0.00
crit 1.40 17.65% 4729.68 4053 5422 3349.53 0 5422 6634 6634 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 487 0.4% 7.9 17.25sec 2779 0 Direct 7.9 2365 4735 2779 17.5%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 0.0000 0.0000 22085.54 22085.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.56 82.53% 2364.94 2026 2711 2351.04 0 2711 15512 15512 0.00
crit 1.39 17.47% 4734.62 4053 5422 3408.72 0 5422 6573 6573 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 816 0.7% 47.6 2.73sec 776 649 Direct 47.6 659 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.58 47.58 0.00 0.00 1.1957 0.0000 36906.47 52762.23 30.05 648.73 648.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.18 82.35% 659.34 562 753 658.64 569 753 25835 36935 30.05
crit 8.40 17.65% 1318.64 1125 1505 1301.73 0 1505 11071 15828 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1040 / 159
Demon Fangs 645 0.6% 10.5 12.79sec 2785 2785 Direct 10.5 2373 4747 2785 17.4%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.50 10.50 0.00 0.00 1.0000 0.0000 29245.58 29245.58 0.00 2785.29 2785.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.68 82.64% 2372.98 2026 2711 2367.76 0 2711 20592 20592 0.00
crit 1.82 17.36% 4746.82 4053 5422 3761.59 0 5422 8654 8654 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 396 0.4% 91.9 1.42sec 194 318 Direct 91.9 165 330 194 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.88 91.88 0.00 0.00 0.6107 0.0000 17868.73 25545.50 30.05 318.49 318.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.63 82.31% 165.26 141 188 164.93 142 187 12499 17868 30.05
crit 16.25 17.69% 330.47 281 376 329.20 0 376 5370 7677 29.99
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - vilefiend 3123 / 1560
Bile Spit 1096 3.2% 6.8 47.19sec 23959 0 Direct 6.8 8823 17648 10396 17.8%  
Periodic 33.4 2776 0 2776 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.45 33.45 0.0000 2.0000 163829.16 163829.16 0.00 2449.23 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.61 82.18% 8823.26 8474 10104 8822.95 8630 9547 49510 49510 0.00
crit 1.22 17.82% 17647.84 16947 20207 12990.94 0 20207 21478 21478 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.4 100.00% 2775.93 2502 3310 2776.32 2622 2868 92841 92841 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.2% 30.1 9.82sec 3650 3650 Direct 30.1 3100 6198 3650 17.8%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.10 30.10 0.00 0.00 1.0000 0.0000 109859.62 157057.53 30.05 3649.82 3649.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.76 82.24% 3099.61 2737 3621 3100.39 2921 3215 76733 109699 30.05
crit 5.34 17.76% 6198.08 5474 7243 6180.85 0 7243 33126 47358 29.96
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1294 3.8% 107.9 2.71sec 1795 1339 Direct 107.9 1526 3051 1795 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.86 107.86 0.00 0.00 1.3407 0.0000 193646.51 276840.94 30.05 1339.16 1339.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.77 82.31% 1525.51 1337 1775 1525.86 1443 1564 135422 193601 30.05
crit 19.08 17.69% 3050.85 2673 3550 3051.38 2787 3298 58225 83240 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - urzul 1302 / 196
Many Faced Bite 491 0.4% 10.5 12.64sec 2095 2095 Direct 10.5 1777 3547 2095 18.0%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.49 10.49 0.00 0.00 1.0000 0.0000 21981.70 31425.48 30.05 2095.09 2095.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.61 82.04% 1777.06 1519 2032 1773.46 0 2032 15299 21871 30.00
crit 1.88 17.96% 3547.11 3037 4064 2818.53 0 4064 6683 9554 23.88
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 811 0.7% 46.6 2.77sec 776 649 Direct 46.6 659 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.63 46.63 0.00 0.00 1.1959 0.0000 36183.62 51728.83 30.05 648.89 648.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.37 82.29% 659.28 562 753 658.20 565 741 25297 36165 30.05
crit 8.26 17.71% 1318.70 1125 1505 1301.44 0 1505 10887 15564 29.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3374 / 2225
Dreadbite 1070 4.1% 29.1 21.05sec 7281 0 Direct 29.1 6175 12356 7281 17.9%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.05 29.05 0.00 0.00 0.0000 0.0000 211502.71 211502.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.85 82.11% 6174.73 5711 7613 6175.01 5971 6360 147288 147288 0.00
crit 5.20 17.89% 12356.41 11423 15227 12314.27 0 15227 64215 64215 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2304 8.9% 311.7 1.90sec 1462 1106 Direct 311.7 1243 2485 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.69 311.69 0.00 0.00 1.3220 0.0000 455670.08 651435.10 30.05 1105.88 1105.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.65 82.34% 1242.55 1105 1473 1242.71 1225 1262 318904 455912 30.05
crit 55.03 17.66% 2485.18 2211 2947 2485.44 2378 2602 136766 195524 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 3114 / 3045
Fel Firebolt 3114 17.9% 1217.8 0.24sec 750 508 Direct 1212.9 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1217.80 1212.89 0.00 0.00 1.4769 0.0000 912983.20 912983.20 0.00 507.62 507.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 998.58 82.33% 639.71 569 761 639.80 630 650 638802 638802 0.00
crit 214.31 17.67% 1279.39 1138 1523 1279.58 1246 1317 274182 274182 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - darkhound 1273 / 194
Fel Bite 462 0.4% 10.0 12.95sec 2095 2095 Direct 10.0 1779 3555 2095 17.8%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.96 9.96 0.00 0.00 1.0000 0.0000 20879.45 29849.68 30.05 2095.49 2095.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.19 82.22% 1779.48 1519 2032 1773.90 0 2032 14579 20842 29.97
crit 1.77 17.78% 3555.48 3037 4064 2770.93 0 4064 6301 9008 23.43
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 812 0.7% 47.0 2.66sec 776 649 Direct 47.0 660 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.99 46.99 0.00 0.00 1.1959 0.0000 36457.00 52119.67 30.05 648.69 648.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.71 82.36% 659.51 562 753 658.32 569 753 25527 36494 30.05
crit 8.29 17.64% 1318.72 1125 1505 1300.41 0 1505 10930 15626 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - demonic_tyrant 4670 / 821
Demonfire 4670 4.8% 37.7 6.88sec 6527 4897 Direct 37.6 5561 11123 6540 17.6%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.66 37.58 0.00 0.00 1.3329 0.0000 245793.77 245793.77 0.00 4897.27 4897.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.97 82.40% 5561.49 5029 5917 5564.84 5451 5666 172219 172219 0.00
crit 6.61 17.60% 11122.93 10059 11834 11115.84 0 11834 73575 73575 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - illidari_satyr 1248 / 192
melee 410 0.4% 47.9 2.65sec 388 326 Direct 47.9 330 660 388 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.87 47.87 0.00 0.00 1.1928 0.0000 18593.50 26581.64 30.05 325.68 325.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.36 82.23% 329.84 281 376 329.53 285 374 12983 18561 30.05
crit 8.50 17.77% 659.74 562 753 651.72 0 753 5610 8020 29.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 205 0.2% 47.9 2.65sec 194 154 Direct 47.9 165 330 194 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.87 47.87 0.00 0.00 1.2623 0.0000 9280.91 13268.17 30.05 153.61 153.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.46 82.43% 164.93 141 188 164.80 142 187 6508 9303 30.05
crit 8.41 17.57% 329.76 281 376 324.46 0 376 2773 3965 29.60
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 633 0.6% 10.4 12.50sec 2795 2795 Direct 10.4 2375 4753 2795 17.6%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.35 10.35 0.00 0.00 1.0000 0.0000 28929.71 28929.71 0.00 2794.87 2794.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.53 82.36% 2375.05 2026 2711 2370.04 0 2711 20249 20249 0.00
crit 1.83 17.64% 4752.80 4053 5422 3742.33 0 5422 8681 8681 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wrathguard 1689 / 255
melee 818 0.7% 47.1 2.76sec 777 652 Direct 47.1 660 1320 777 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.07 47.07 0.00 0.00 1.1903 0.0000 36560.14 52267.12 30.05 652.48 652.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.73 82.28% 659.71 562 753 658.80 0 739 25553 36530 30.04
crit 8.34 17.72% 1319.70 1125 1505 1302.65 0 1505 11008 15737 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 409 0.4% 47.1 2.76sec 388 308 Direct 47.1 330 660 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.07 47.07 0.00 0.00 1.2599 0.0000 18272.57 26122.83 30.05 308.10 308.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.76 82.34% 329.83 281 376 329.46 285 368 12784 18276 30.05
crit 8.31 17.66% 660.10 562 753 648.19 0 753 5489 7847 29.54
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 462 0.4% 9.9 13.45sec 2097 2097 Direct 9.9 1779 3557 2097 17.9%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.93 9.93 0.00 0.00 1.0000 0.0000 20824.66 29771.35 30.05 2096.72 2096.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.16 82.14% 1779.06 1519 2032 1772.94 0 1993 14514 20749 29.94
crit 1.77 17.86% 3557.20 3037 4064 2759.98 0 4064 6311 9022 23.31
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bilescourge 3832 / 587
Toxic Bile 3832 3.4% 62.1 2.02sec 2801 2966 Direct 62.0 2383 4765 2802 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.06 62.03 0.00 0.00 0.9443 0.0000 173824.60 173824.60 0.00 2966.24 2966.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.12 82.41% 2383.22 2026 2711 2379.49 0 2634 121836 121836 0.00
crit 10.91 17.59% 4764.61 4053 5422 4736.81 0 5422 51989 51989 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - shivarra 1896 / 286
melee 815 0.7% 46.8 2.70sec 775 650 Direct 46.8 660 1319 775 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.83 46.83 0.00 0.00 1.1934 0.0000 36312.59 51913.22 30.05 649.74 649.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.62 82.46% 659.72 562 753 658.87 565 741 25476 36422 30.05
crit 8.21 17.54% 1319.37 1125 1505 1301.33 0 1505 10836 15492 29.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 408 0.4% 46.8 2.70sec 388 307 Direct 46.8 330 660 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.83 46.83 0.00 0.00 1.2630 0.0000 18180.99 25991.91 30.05 307.40 307.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.54 82.30% 329.85 281 376 329.41 282 370 12714 18176 30.05
crit 8.29 17.70% 659.76 562 753 651.95 0 753 5467 7816 29.73
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (102) 0.0% (0.6%) 0.0 0.00sec 0 3932

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3931.56 3931.56
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 168 0.1% 7.7 17.53sec 983 0 Direct 7.7 836 1672 983 17.6%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.66 7.66 0.00 0.00 0.0000 0.0000 7530.64 10765.95 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.31 82.36% 835.67 717 959 831.63 0 959 5272 7537 29.92
crit 1.35 17.64% 1671.59 1434 1919 1176.35 0 1919 2259 3229 21.16
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 168 0.1% 7.7 17.53sec 980 0 Direct 7.7 836 1670 980 17.3%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.66 7.66 0.00 0.00 0.0000 0.0000 7509.34 10735.50 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.33 82.68% 835.84 717 959 831.76 0 959 5293 7567 29.92
crit 1.33 17.32% 1669.96 1434 1919 1166.70 0 1919 2216 3168 21.00
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 168 0.1% 7.7 17.53sec 984 0 Direct 7.7 836 1671 984 17.8%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.66 7.66 0.00 0.00 0.0000 0.0000 7540.12 10779.51 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.30 82.21% 835.73 717 959 832.57 0 944 5262 7523 29.94
crit 1.36 17.79% 1671.05 1434 1919 1189.45 0 1919 2278 3256 21.40
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 168 0.1% 7.7 17.53sec 983 0 Direct 7.7 836 1672 983 17.6%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.66 7.66 0.00 0.00 0.0000 0.0000 7531.72 10767.50 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.31 82.35% 835.59 717 959 831.66 0 959 5271 7535 29.90
crit 1.35 17.65% 1672.39 1434 1919 1174.77 0 1919 2261 3232 21.11
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - prince_malchezaar 4496 / 389
melee 3000 1.5% 20.9 1.63sec 3667 3059 Direct 20.9 3125 6262 3667 17.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.89 20.89 0.00 0.00 1.1988 0.0000 76621.06 109539.01 30.05 3059.21 3059.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.28 82.71% 3124.96 2665 3566 3117.59 2699 3502 54003 77204 30.05
crit 3.61 17.29% 6262.15 5330 7131 5917.64 0 7131 22618 32335 28.46
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1497 0.8% 20.9 1.63sec 1831 1442 Direct 20.9 1564 3121 1831 17.2%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.89 20.89 0.00 0.00 1.2695 0.0000 38248.26 54680.48 30.05 1442.08 1442.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.31 82.85% 1563.53 1333 1783 1559.45 1350 1759 27064 38691 30.05
crit 3.58 17.15% 3121.01 2665 3566 2982.05 0 3509 11184 15989 28.76
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 978 / 82
Eye of Gul'dan 978 0.5% 28.1 5.34sec 865 1133 Periodic 60.9 399 0 399 0.0% 59.6%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.06 0.00 60.90 60.90 0.7636 2.9376 24280.39 24280.39 0.00 121.21 1133.01
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.9 100.00% 398.72 182 484 396.75 0 430 24280 24280 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DStr_ID_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.96sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.05sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 0.00 0.00 0.00 1.2043 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2381 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.55sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5084 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 17.8 14.58sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.19sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5528 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.57% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.6 23.3sec 10.2sec 52.05% 83.52% 15.6(15.6) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.05%

Trigger Attempt Success

  • trigger_pct:19.99%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.5 32.1 11.7sec 5.0sec 40.26% 100.00% 4.8(4.8) 0.4

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.46%
  • demonic_core_2:15.92%
  • demonic_core_3:5.40%
  • demonic_core_4:2.48%

Trigger Attempt Success

  • trigger_pct:23.56%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.60% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.7sec 10.2sec 65.95% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.60%
  • dreadstalkers_4:6.34%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 169.3sec 3.1sec 1.42% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.82% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.9sec 0.0sec 10.14% 17.98% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 66.9sec 36.8sec 44.04% 0.00% 2.9(40.7) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.77%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.92%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.15%
  • overwhelming_power_21:2.21%
  • overwhelming_power_22:2.27%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.4 182.9sec 14.5sec 19.52% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.70%
  • portal_summons_2:0.77%
  • portal_summons_3:1.25%
  • portal_summons_4:1.53%
  • portal_summons_5:1.85%
  • portal_summons_6:1.82%
  • portal_summons_7:3.98%
  • portal_summons_8:5.86%
  • portal_summons_9:0.77%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 173.2sec 117.5sec 1.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.54% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.63%
  • quick_navigation_2:16.98%
  • quick_navigation_3:16.69%
  • quick_navigation_4:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.4 0.0 52.2sec 52.2sec 17.50% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.6sec 79.9sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.60% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.60%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.99% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.99%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.1 133.0sec 0.0sec 97.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.42%
  • wild_imps_2:2.04%
  • wild_imps_3:10.39%
  • wild_imps_4:20.95%
  • wild_imps_5:8.09%
  • wild_imps_6:14.82%
  • wild_imps_7:18.55%
  • wild_imps_8:5.03%
  • wild_imps_9:3.52%
  • wild_imps_10:3.96%
  • wild_imps_11:4.17%
  • wild_imps_12:1.73%
  • wild_imps_13:1.22%
  • wild_imps_14:1.28%
  • wild_imps_15:0.36%
  • wild_imps_16:0.17%
  • wild_imps_17:0.07%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 13.9sec
one_shard_hog 8.9 21.8sec
two_shard_hog 4.2 48.2sec
three_shard_hog 49.7 5.7sec
portal_summon 15.4 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_ID_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 48.0 95982.8 2000.0 2042.5 4.2
hand_of_guldan Soul Shard 62.9 166.5 2.6 2.6 1979.1
shadow_bolt Mana 94.0 188071.2 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7153.3 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.8 4152.2 40.0 40.0 226.5
pet - wild_imp
fel_firebolt Energy 1217.8 18635.7 15.3 15.3 49.0
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 47.99 95.84 (50.48%) 2.00 0.14 0.15%
shadow_bolt Soul Shard 94.04 94.03 (49.52%) 1.00 0.00 0.00%
mana_regen Mana 556.96 288347.97 (100.00%) 517.71 11114.64 3.71%
pet - imp
energy_regen Energy 425.67 3981.56 (100.00%) 9.35 22.74 0.57%
pet - demonic_tyrant
energy_regen Energy 37.66 0.00 (0.00%) 0.00 760.11 100.00%
pet - bilescourge
energy_regen Energy 11.53 0.00 (0.00%) 0.00 158.97 100.00%
pet - bilescourge
energy_regen Energy 13.42 0.00 (0.00%) 0.00 186.71 100.00%
pet - bilescourge
energy_regen Energy 11.36 0.00 (0.00%) 0.00 156.65 100.00%
pet - bilescourge
energy_regen Energy 12.50 0.00 (0.00%) 0.00 173.61 100.00%
pet - bilescourge
energy_regen Energy 11.39 0.00 (0.00%) 0.00 157.95 100.00%
pet - bilescourge
energy_regen Energy 0.65 0.00 (0.00%) 0.00 9.15 100.00%
Resource RPS-Gain RPS-Loss
Mana 961.12 970.66
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97135.38 91831.00 100000.00
Soul Shard 2.54 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DStr_ID_Imp Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_ID_Imp Damage Per Second
Count 4999
Mean 17033.57
Minimum 15436.38
Maximum 19522.48
Spread ( max - min ) 4086.09
Range [ ( max - min ) / 2 * 100% ] 11.99%
Standard Deviation 556.8518
5th Percentile 16200.57
95th Percentile 18051.54
( 95th Percentile - 5th Percentile ) 1850.97
Mean Distribution
Standard Deviation 7.8759
95.00% Confidence Intervall ( 17018.14 - 17049.01 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4106
0.1 Scale Factor Error with Delta=300 2648
0.05 Scale Factor Error with Delta=300 10589
0.01 Scale Factor Error with Delta=300 264706
Priority Target DPS
Sample Data DStr_ID_Imp Priority Target Damage Per Second
Count 4999
Mean 17033.57
Minimum 15436.38
Maximum 19522.48
Spread ( max - min ) 4086.09
Range [ ( max - min ) / 2 * 100% ] 11.99%
Standard Deviation 556.8518
5th Percentile 16200.57
95th Percentile 18051.54
( 95th Percentile - 5th Percentile ) 1850.97
Mean Distribution
Standard Deviation 7.8759
95.00% Confidence Intervall ( 17018.14 - 17049.01 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4106
0.1 Scale Factor Error with Delta=300 2648
0.05 Scale Factor Error with Delta=300 10589
0.01 Scale Factor Error with Delta=300 264706
DPS(e)
Sample Data DStr_ID_Imp Damage Per Second (Effective)
Count 4999
Mean 17033.57
Minimum 15436.38
Maximum 19522.48
Spread ( max - min ) 4086.09
Range [ ( max - min ) / 2 * 100% ] 11.99%
Damage
Sample Data DStr_ID_Imp Damage
Count 4999
Mean 1272034.63
Minimum 898242.70
Maximum 1695847.99
Spread ( max - min ) 797605.28
Range [ ( max - min ) / 2 * 100% ] 31.35%
DTPS
Sample Data DStr_ID_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_ID_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_ID_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_ID_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_ID_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_ID_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_ID_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_ID_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.87 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.56 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.18 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 42.87 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.55 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.43 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.13 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.03 call_dreadstalkers
X 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.93 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJJJJEGHJGHJGHHGJJGHHGJJJEJDGHJGJJHGHJJEGJJGJJJGHJJJGJEHGHJDJGF8JHGJJJJEGJJHGHGHHGHGHHJEGHGHHJGDHGHHJGEHHGJJJJYJJJYJJWXJJJJJVQQTNQR9ATOQTQTQJQJQJJHGHHGJEJJGJJJGJHGHJJJDEGJJJGJJHGHJJGEJJJGJJJGHHGHJJEJDGFHGJJJGJJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active N summon_vilefiend Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.585 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:03.885 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:04.861 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:06.162 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.139 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98982.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.440 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.440 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.440 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.535 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97100.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.357 build_a_shard J shadow_bolt Fluffy_Pillow 97922.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.452 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97017.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.269 build_a_shard J shadow_bolt Fluffy_Pillow 97834.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.357 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96922.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.149 build_a_shard J shadow_bolt Fluffy_Pillow 97714.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.202 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96767.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.994 build_a_shard J shadow_bolt Fluffy_Pillow 97559.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:17.049 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96614.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.815 build_a_shard J shadow_bolt Fluffy_Pillow 97380.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.836 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96401.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.713 build_a_shard J shadow_bolt Fluffy_Pillow 97278.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.880 build_a_shard J shadow_bolt Fluffy_Pillow 96445.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.014 build_a_shard J shadow_bolt Fluffy_Pillow 95579.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.147 build_a_shard J shadow_bolt Fluffy_Pillow 94712.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.278 default E call_dreadstalkers Fluffy_Pillow 93843.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.129 default G hand_of_guldan Fluffy_Pillow 94694.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:25.953 default H demonbolt Fluffy_Pillow 95518.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.779 build_a_shard J shadow_bolt Fluffy_Pillow 94344.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.880 default G hand_of_guldan Fluffy_Pillow 93445.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.702 default H demonbolt Fluffy_Pillow 94267.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6)
0:29.660 build_a_shard J shadow_bolt Fluffy_Pillow 93225.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(6)
0:30.937 default G hand_of_guldan Fluffy_Pillow 92502.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:31.894 default H demonbolt Fluffy_Pillow 93459.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:32.854 default H demonbolt Fluffy_Pillow 92419.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(7)
0:33.811 default G hand_of_guldan Fluffy_Pillow 91376.0/100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(7)
0:34.770 build_a_shard J shadow_bolt Fluffy_Pillow 92335.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(7)
0:35.988 build_a_shard J shadow_bolt Fluffy_Pillow 91553.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(8)
0:37.207 default G hand_of_guldan Fluffy_Pillow 90772.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation_final, archive_of_the_titans(8)
0:38.121 default H demonbolt Fluffy_Pillow 91686.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation_final, archive_of_the_titans(8)
0:39.036 default H demonbolt Fluffy_Pillow 90601.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(8)
0:39.950 default G hand_of_guldan Fluffy_Pillow 89515.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(8)
0:40.865 build_a_shard J shadow_bolt Fluffy_Pillow 90430.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(9)
0:42.084 build_a_shard J shadow_bolt Fluffy_Pillow 89649.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:43.668 build_a_shard J shadow_bolt Fluffy_Pillow 89233.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:45.249 default E call_dreadstalkers Fluffy_Pillow 88814.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), archive_of_the_titans(10)
0:46.525 build_a_shard J shadow_bolt Fluffy_Pillow 90090.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), archive_of_the_titans(10)
0:48.226 default D summon_vilefiend Fluffy_Pillow 89791.0/100000: 90% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), archive_of_the_titans(10)
0:49.925 default G hand_of_guldan Fluffy_Pillow 91490.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, archive_of_the_titans(10)
0:51.202 default H demonbolt Fluffy_Pillow 92767.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps, dreadstalkers(2), vilefiend, archive_of_the_titans(11)
0:52.477 build_a_shard J shadow_bolt Fluffy_Pillow 92042.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, archive_of_the_titans(11)
0:54.179 default G hand_of_guldan Fluffy_Pillow 91744.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:55.447 build_a_shard J shadow_bolt Fluffy_Pillow 93012.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(12)
0:57.137 build_a_shard J shadow_bolt Fluffy_Pillow 92702.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(12)
0:58.815 default H demonbolt Fluffy_Pillow 92380.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), archive_of_the_titans(12)
1:00.075 default G hand_of_guldan Fluffy_Pillow 91640.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:01.334 default H demonbolt Fluffy_Pillow 92899.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation(3), archive_of_the_titans(13)
1:02.587 build_a_shard J shadow_bolt Fluffy_Pillow 92152.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(3), archive_of_the_titans(13)
1:04.255 build_a_shard J shadow_bolt Fluffy_Pillow 91820.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(3), archive_of_the_titans(13)
1:05.925 default E call_dreadstalkers Fluffy_Pillow 91490.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(14)
1:07.177 default G hand_of_guldan Fluffy_Pillow 92742.0/100000: 93% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(14)
1:08.429 build_a_shard J shadow_bolt Fluffy_Pillow 93994.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(14)
1:10.098 build_a_shard J shadow_bolt Fluffy_Pillow 93663.0/100000: 94% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:11.767 default G hand_of_guldan Fluffy_Pillow 93332.0/100000: 93% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:13.019 build_a_shard J shadow_bolt Fluffy_Pillow 94584.0/100000: 95% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:14.690 build_a_shard J shadow_bolt Fluffy_Pillow 94255.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:16.358 build_a_shard J shadow_bolt Fluffy_Pillow 93923.0/100000: 94% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(16)
1:18.028 default G hand_of_guldan Fluffy_Pillow 93593.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(6), quick_navigation(4), archive_of_the_titans(16)
1:19.273 default H demonbolt Fluffy_Pillow 94838.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(4), quick_navigation(4), archive_of_the_titans(16)
1:20.517 build_a_shard J shadow_bolt Fluffy_Pillow 94082.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), quick_navigation(4), archive_of_the_titans(17)
1:22.175 build_a_shard J shadow_bolt Fluffy_Pillow 93740.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), quick_navigation(4), archive_of_the_titans(17)
1:23.834 build_a_shard J shadow_bolt Fluffy_Pillow 93399.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), quick_navigation(4), archive_of_the_titans(17)
1:25.491 default G hand_of_guldan Fluffy_Pillow 93056.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(4), quick_navigation(4), archive_of_the_titans(18)
1:26.734 build_a_shard J shadow_bolt Fluffy_Pillow 94299.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), quick_navigation(4), archive_of_the_titans(18)
1:28.392 default E call_dreadstalkers Fluffy_Pillow 93957.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), quick_navigation(4), archive_of_the_titans(18)
1:30.051 default H demonbolt Fluffy_Pillow 95616.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:31.296 default G hand_of_guldan Fluffy_Pillow 94861.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:32.540 default H demonbolt Fluffy_Pillow 96105.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(19)
1:33.621 build_a_shard J shadow_bolt Fluffy_Pillow 95186.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(19)
1:35.070 default D summon_vilefiend Fluffy_Pillow 94635.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
1:36.472 build_a_shard J shadow_bolt Fluffy_Pillow 96037.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
1:37.884 default G hand_of_guldan Fluffy_Pillow 95449.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
1:38.948 default F summon_demonic_tyrant Fluffy_Pillow 96513.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
1:40.373 default 8 potion Fluffy_Pillow 95938.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
1:40.373 build_a_shard J shadow_bolt Fluffy_Pillow 95938.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
1:41.814 default H demonbolt Fluffy_Pillow 95379.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
1:42.904 default G hand_of_guldan Fluffy_Pillow 94469.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
1:43.996 build_a_shard J shadow_bolt Fluffy_Pillow 95561.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
1:45.460 build_a_shard J shadow_bolt Fluffy_Pillow 95025.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
1:47.043 build_a_shard J shadow_bolt Fluffy_Pillow 94608.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect
1:48.646 build_a_shard J shadow_bolt Fluffy_Pillow 94211.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(9), archive_of_the_titans(20), battle_potion_of_intellect
1:50.258 default E call_dreadstalkers Fluffy_Pillow 93823.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect
1:51.481 default G hand_of_guldan Fluffy_Pillow 95046.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, overwhelming_power(6), archive_of_the_titans(20), battle_potion_of_intellect
1:52.713 build_a_shard J shadow_bolt Fluffy_Pillow 96278.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, overwhelming_power(5), archive_of_the_titans(20), battle_potion_of_intellect
1:54.362 build_a_shard J shadow_bolt Fluffy_Pillow 95927.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(10), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(3), archive_of_the_titans(20), battle_potion_of_intellect
1:56.021 default H demonbolt Fluffy_Pillow 95586.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation, overwhelming_power, archive_of_the_titans(20), battle_potion_of_intellect
1:57.281 default G hand_of_guldan Fluffy_Pillow 94846.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:58.550 default H demonbolt Fluffy_Pillow 96115.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:59.818 default G hand_of_guldan Fluffy_Pillow 95383.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:01.085 default H demonbolt Fluffy_Pillow 96650.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:02.353 default H demonbolt Fluffy_Pillow 95918.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, supreme_commander, wild_imps(10), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:03.623 default G hand_of_guldan Fluffy_Pillow 95188.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(4), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:04.889 default H demonbolt Fluffy_Pillow 96454.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(4), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:06.158 default G hand_of_guldan Fluffy_Pillow 95723.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation, archive_of_the_titans(20)
2:07.428 default H demonbolt Fluffy_Pillow 96993.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(10), quick_navigation(2), archive_of_the_titans(20)
2:08.688 default H demonbolt Fluffy_Pillow 96253.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, supreme_commander, wild_imps(8), quick_navigation(2), archive_of_the_titans(20)
2:09.948 build_a_shard J shadow_bolt Fluffy_Pillow 95513.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(9), quick_navigation(2), archive_of_the_titans(20)
2:11.627 default E call_dreadstalkers Fluffy_Pillow 95192.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
2:12.879 default G hand_of_guldan Fluffy_Pillow 96444.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(4), wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:14.132 default H demonbolt Fluffy_Pillow 97697.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(4), wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:15.383 default G hand_of_guldan Fluffy_Pillow 96948.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(4), wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:16.635 default H demonbolt Fluffy_Pillow 98200.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(4), wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:17.888 default H demonbolt Fluffy_Pillow 97453.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(4), wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:19.141 build_a_shard J shadow_bolt Fluffy_Pillow 96706.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:20.811 default G hand_of_guldan Fluffy_Pillow 96376.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(3), wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:22.057 default D summon_vilefiend Fluffy_Pillow 97622.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:23.718 default H demonbolt Fluffy_Pillow 99283.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(4), wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:24.964 default G hand_of_guldan Fluffy_Pillow 98529.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:26.210 default H demonbolt Fluffy_Pillow 99775.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:27.455 default H demonbolt Fluffy_Pillow 99020.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(5), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:28.701 build_a_shard J shadow_bolt Fluffy_Pillow 98266.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:30.360 default G hand_of_guldan Fluffy_Pillow 97925.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:31.604 default E call_dreadstalkers Fluffy_Pillow 99169.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:33.288 default H demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:34.535 default H demonbolt Fluffy_Pillow 99247.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:35.781 default G hand_of_guldan Fluffy_Pillow 98493.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:37.026 build_a_shard J shadow_bolt Fluffy_Pillow 99738.0/100000: 100% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:38.686 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:40.344 build_a_shard J shadow_bolt Fluffy_Pillow 97663.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:41.928 build_a_shard J shadow_bolt Fluffy_Pillow 97247.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:43.511 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96830.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:44.700 build_a_shard J shadow_bolt Fluffy_Pillow 98019.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:46.282 build_a_shard J shadow_bolt Fluffy_Pillow 97601.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:47.865 build_a_shard J shadow_bolt Fluffy_Pillow 97184.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:49.449 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96768.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:50.637 build_a_shard J shadow_bolt Fluffy_Pillow 97956.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), archive_of_the_titans(20)
2:52.338 build_a_shard J shadow_bolt Fluffy_Pillow 97657.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(20)
2:54.039 nether_portal_building W call_dreadstalkers Fluffy_Pillow 97358.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
2:55.305 nether_portal_building X hand_of_guldan Fluffy_Pillow 98624.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:56.572 build_a_shard J shadow_bolt Fluffy_Pillow 99891.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:58.262 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:59.952 build_a_shard J shadow_bolt Fluffy_Pillow 97695.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
3:01.409 build_a_shard J shadow_bolt Fluffy_Pillow 97152.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
3:02.879 build_a_shard J shadow_bolt Fluffy_Pillow 96622.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
3:04.359 nether_portal_building V nether_portal Fluffy_Pillow 96102.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
3:05.483 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97226.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), portal_summons, quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
3:06.609 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98352.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps, portal_summons(2), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
3:07.701 nether_portal_active T demonbolt Fluffy_Pillow 99444.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, portal_summons(3), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
3:08.800 nether_portal_active N summon_vilefiend Fluffy_Pillow 98543.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(3), portal_summons(3), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
3:10.274 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(4), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
3:11.391 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(5), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
3:12.886 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
3:12.886 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse
3:12.886 nether_portal_active T demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse
3:13.839 nether_portal_active O call_dreadstalkers Fluffy_Pillow 96957.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse
3:15.002 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98120.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse
3:15.970 nether_portal_active T demonbolt Fluffy_Pillow 99088.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse
3:16.938 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98056.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(2)
3:17.884 nether_portal_active T demonbolt Fluffy_Pillow 99002.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.829 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97947.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.780 build_a_shard J shadow_bolt Fluffy_Pillow 98898.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.046 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse(3)
3:21.979 build_a_shard J shadow_bolt Fluffy_Pillow 98937.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.223 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(13), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.308 build_a_shard J shadow_bolt Fluffy_Pillow 99090.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(14), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(7), archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.761 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(15), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.177 default H demonbolt Fluffy_Pillow 97422.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_power, wild_imps(15), vilefiend, tyrant, portal_summons(8), quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.253 default G hand_of_guldan Fluffy_Pillow 96498.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(15), vilefiend, portal_summons(8), quick_navigation(4), overwhelming_power(3), archive_of_the_titans(20), ignition_mages_fuse(4)
3:29.335 default H demonbolt Fluffy_Pillow 97580.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(15), vilefiend, portal_summons(8), quick_navigation(4), overwhelming_power(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:30.391 default H demonbolt Fluffy_Pillow 96636.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(13), vilefiend, portal_summons(8), quick_navigation(4), overwhelming_power, archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.452 default G hand_of_guldan Fluffy_Pillow 95697.0/100000: 96% mana | 5.0/5: 100% soul_shard supreme_commander, wild_imps(15), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.519 build_a_shard J shadow_bolt Fluffy_Pillow 96764.0/100000: 97% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(13), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.943 default E call_dreadstalkers Fluffy_Pillow 96188.0/100000: 96% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(12), vilefiend, quick_navigation(4), archive_of_the_titans(20)
3:35.698 build_a_shard J shadow_bolt Fluffy_Pillow 97943.0/100000: 98% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
3:37.356 build_a_shard J shadow_bolt Fluffy_Pillow 97601.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
3:39.015 default G hand_of_guldan Fluffy_Pillow 97260.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:40.202 build_a_shard J shadow_bolt Fluffy_Pillow 98447.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:41.785 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:43.368 build_a_shard J shadow_bolt Fluffy_Pillow 97588.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:44.951 default G hand_of_guldan Fluffy_Pillow 97171.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:46.137 build_a_shard J shadow_bolt Fluffy_Pillow 98357.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:47.718 default H demonbolt Fluffy_Pillow 97938.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
3:48.906 default G hand_of_guldan Fluffy_Pillow 97126.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(20)
3:50.095 default H demonbolt Fluffy_Pillow 98315.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), archive_of_the_titans(20)
3:51.372 build_a_shard J shadow_bolt Fluffy_Pillow 97592.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), archive_of_the_titans(20)
3:53.072 build_a_shard J shadow_bolt Fluffy_Pillow 97292.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), archive_of_the_titans(20)
3:54.772 build_a_shard J shadow_bolt Fluffy_Pillow 96992.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), archive_of_the_titans(20)
3:56.472 default D summon_vilefiend Fluffy_Pillow 96692.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), archive_of_the_titans(20)
3:58.173 default E call_dreadstalkers Fluffy_Pillow 98393.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), vilefiend, archive_of_the_titans(20)
3:59.449 default G hand_of_guldan Fluffy_Pillow 99669.0/100000: 100% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:00.727 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps, dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:02.428 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
4:04.117 build_a_shard J shadow_bolt Fluffy_Pillow 97694.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
4:05.806 default G hand_of_guldan Fluffy_Pillow 97383.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
4:07.075 build_a_shard J shadow_bolt Fluffy_Pillow 98652.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
4:08.764 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
4:10.453 default H demonbolt Fluffy_Pillow 97693.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), vilefiend, quick_navigation, archive_of_the_titans(20)
4:11.722 default G hand_of_guldan Fluffy_Pillow 96962.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), vilefiend, quick_navigation, archive_of_the_titans(20)
4:12.991 default H demonbolt Fluffy_Pillow 98231.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(20)
4:14.259 build_a_shard J shadow_bolt Fluffy_Pillow 97499.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), quick_navigation, archive_of_the_titans(20)
4:15.949 build_a_shard J shadow_bolt Fluffy_Pillow 97189.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(7), quick_navigation(2), archive_of_the_titans(20)
4:17.630 default G hand_of_guldan Fluffy_Pillow 96870.0/100000: 97% mana | 5.0/5: 100% soul_shard wild_imps(4), quick_navigation(2), archive_of_the_titans(20)
4:18.890 default E call_dreadstalkers Fluffy_Pillow 98130.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), quick_navigation(2), archive_of_the_titans(20)
4:20.570 build_a_shard J shadow_bolt Fluffy_Pillow 99810.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:22.240 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:23.911 build_a_shard J shadow_bolt Fluffy_Pillow 97676.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:25.581 default G hand_of_guldan Fluffy_Pillow 97346.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:26.827 build_a_shard J shadow_bolt Fluffy_Pillow 98592.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:28.486 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:30.146 build_a_shard J shadow_bolt Fluffy_Pillow 97664.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:31.806 default G hand_of_guldan Fluffy_Pillow 97324.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:33.052 default H demonbolt Fluffy_Pillow 98570.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
4:34.298 default H demonbolt Fluffy_Pillow 97816.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(20)
4:35.544 default G hand_of_guldan Fluffy_Pillow 97062.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
4:36.789 default H demonbolt Fluffy_Pillow 98307.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:37.976 build_a_shard J shadow_bolt Fluffy_Pillow 97494.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:39.557 build_a_shard J shadow_bolt Fluffy_Pillow 97075.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(20)
4:41.139 default E call_dreadstalkers Fluffy_Pillow 96657.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(20)
4:42.329 build_a_shard J shadow_bolt Fluffy_Pillow 97847.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:43.910 default D summon_vilefiend Fluffy_Pillow 97428.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:45.491 default G hand_of_guldan Fluffy_Pillow 99009.0/100000: 99% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:46.679 default F summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:48.264 default H demonbolt Fluffy_Pillow 98007.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20)
4:49.539 default G hand_of_guldan Fluffy_Pillow 97282.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(24), archive_of_the_titans(20)
4:50.649 build_a_shard J shadow_bolt Fluffy_Pillow 98392.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
4:52.127 build_a_shard J shadow_bolt Fluffy_Pillow 97870.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
4:53.615 build_a_shard J shadow_bolt Fluffy_Pillow 97358.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
4:55.109 default G hand_of_guldan Fluffy_Pillow 96852.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
4:56.237 build_a_shard J shadow_bolt Fluffy_Pillow 97980.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20)
4:57.749 build_a_shard J shadow_bolt Fluffy_Pillow 97492.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20)
4:59.269 build_a_shard J shadow_bolt Fluffy_Pillow 97012.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_ID_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=imp

Simulation & Raid Information

Iterations: 5003
Threads: 4
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 257693323
Max Event Queue: 984
Sim Seconds: 1500952
CPU Seconds: 477.2813
Physical Seconds: 121.1726
Speed Up: 3145

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
DL_GF_Felguard DL_GF_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.27sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard demonbolt 264178 375712 1252 8.99 7109 14225 44.1 45.0 17.5% 0.0% 0.0% 0.0% 6.21sec 375712 300.01sec
DL_GF_Felguard DL_GF_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.75sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard hand_of_guldan 105174 315603 1052 12.06 4447 8903 60.4 60.3 17.7% 0.0% 0.0% 0.0% 4.90sec 315603 300.01sec
DL_GF_Felguard DL_GF_Felguard heed_my_call 271685 42394 141 1.46 4925 9849 7.3 7.3 18.0% 0.0% 0.0% 0.0% 36.80sec 42394 300.01sec
DL_GF_Felguard DL_GF_Felguard heed_my_call_aoe 271686 18105 60 1.46 2111 4221 7.3 7.3 17.6% 0.0% 0.0% 0.0% 36.80sec 18105 300.01sec
DL_GF_Felguard DL_GF_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard shadow_bolt 686 402714 1342 19.03 3595 7191 95.8 95.1 17.8% 0.0% 0.0% 0.0% 3.05sec 402714 300.01sec
DL_GF_Felguard DL_GF_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.46sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard summon_random_demon 0 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 14.67sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.25sec 0 300.01sec
DL_GF_Felguard DL_GF_Felguard volatile_blood_explosion 278057 86826 289 1.44 10240 20481 7.3 7.2 17.6% 0.0% 0.0% 0.0% 37.04sec 86826 300.01sec
DL_GF_Felguard DL_GF_Felguard_felguard felstorm ticks -89751 113540 378 12.42 1553 3105 10.4 62.1 17.7% 0.0% 0.0% 0.0% 30.14sec 162318 300.01sec
DL_GF_Felguard DL_GF_Felguard_felguard legion_strike 30213 317767 1059 11.68 4626 9252 58.4 58.4 17.6% 0.0% 0.0% 0.0% 5.09sec 454286 300.01sec
DL_GF_Felguard DL_GF_Felguard_felguard melee 0 516770 1723 34.75 2529 5055 173.7 173.7 17.6% 0.0% 0.0% 0.0% 1.71sec 738784 300.01sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.14sec 0 64.41sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard felstorm ticks -89751 41869 140 3.89 1830 3661 3.9 19.5 17.5% 0.0% 0.0% 0.0% 80.78sec 59857 64.41sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard legion_strike 30213 118959 1847 17.18 5476 10970 18.4 18.4 17.7% 0.0% 0.0% 0.0% 13.89sec 170066 64.41sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard melee 0 145565 2260 38.15 3020 6043 41.0 41.0 17.7% 0.0% 0.0% 0.0% 6.34sec 208103 64.41sec
DL_GF_Felguard DL_GF_Felguard_vicious_hellhound demon_fangs 272013 26347 2409 51.26 2393 4792 9.3 9.3 17.8% 0.0% 0.0% 0.0% 12.07sec 26347 10.94sec
DL_GF_Felguard DL_GF_Felguard_vicious_hellhound melee 0 16231 1484 454.38 167 333 82.8 82.8 17.7% 0.0% 0.0% 0.0% 1.31sec 23203 10.94sec
DL_GF_Felguard DL_GF_Felguard_shivarra melee 0 33181 3520 270.11 665 1329 42.4 42.4 17.6% 0.0% 0.0% 0.0% 2.57sec 47436 9.43sec
DL_GF_Felguard DL_GF_Felguard_shivarra melee_oh 0 16584 1759 270.11 332 665 42.4 42.4 17.6% 0.0% 0.0% 0.0% 2.57sec 23709 9.43sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 9.43sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash1 272172 6802 722 43.65 844 1687 6.9 6.9 17.6% 0.0% 0.0% 0.0% 17.19sec 9724 9.43sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash2 272172 6812 723 43.65 844 1690 6.9 6.9 17.7% 0.0% 0.0% 0.0% 17.19sec 9738 9.43sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash3 272172 6813 723 43.65 843 1691 6.9 6.9 17.7% 0.0% 0.0% 0.0% 17.19sec 9740 9.43sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash4 272172 6810 722 43.65 844 1690 6.9 6.9 17.7% 0.0% 0.0% 0.0% 17.19sec 9735 9.43sec
DL_GF_Felguard DL_GF_Felguard_vilefiend bile_spit 267997 71128 501 2.86 8928 17884 6.8 6.8 17.5% 0.0% 0.0% 0.0% 47.25sec 164762 141.94sec
DL_GF_Felguard DL_GF_Felguard_vilefiend bile_spit ticks -267997 93633 312 6.64 2822 0 6.8 33.2 0.0% 0.0% 0.0% 0.0% 47.25sec 164762 141.94sec
DL_GF_Felguard DL_GF_Felguard_vilefiend headbutt 267999 104013 733 12.04 3106 6208 28.5 28.5 17.5% 0.0% 0.0% 0.0% 10.29sec 148700 141.94sec
DL_GF_Felguard DL_GF_Felguard_vilefiend melee 0 185175 1305 43.44 1531 3062 102.8 102.8 17.7% 0.0% 0.0% 0.0% 2.83sec 264730 141.94sec
DL_GF_Felguard DL_GF_Felguard_dreadstalker dreadbite 205196 263978 2440 16.13 7720 15435 29.1 29.1 17.6% 0.0% 0.0% 0.0% 20.93sec 263978 108.20sec
DL_GF_Felguard DL_GF_Felguard_dreadstalker melee 0 456993 4224 173.17 1244 2487 312.3 312.3 17.7% 0.0% 0.0% 0.0% 1.89sec 653327 108.20sec
DL_GF_Felguard DL_GF_Felguard_wild_imp fel_firebolt 104318 742522 10533 843.28 637 1274 994.9 990.8 17.6% 0.0% 0.0% 0.0% 0.29sec 742522 70.50sec
DL_GF_Felguard DL_GF_Felguard_demonic_tyrant demonfire 270481 246790 4646 42.58 5561 11119 37.8 37.7 17.7% 0.0% 0.0% 0.0% 6.91sec 246790 53.12sec
DL_GF_Felguard DL_GF_Felguard_wrathguard melee 0 33589 4739 363.12 665 1330 42.9 42.9 17.8% 0.0% 0.0% 0.0% 2.65sec 48019 7.09sec
DL_GF_Felguard DL_GF_Felguard_wrathguard melee_oh 0 16783 2368 363.12 332 665 42.9 42.9 17.7% 0.0% 0.0% 0.0% 2.65sec 23993 7.09sec
DL_GF_Felguard DL_GF_Felguard_wrathguard overhead_assault 272432 18887 2665 75.71 1795 3592 8.9 8.9 17.6% 0.0% 0.0% 0.0% 13.16sec 27001 7.09sec
DL_GF_Felguard DL_GF_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24059 80 12.02 400 0 27.6 60.1 0.0% 0.0% 0.0% 0.0% 4.62sec 24059 11.89sec
DL_GF_Felguard DL_GF_Felguard_bilescourge toxic_bile 272167 154128 10788 229.11 2401 4800 54.6 54.6 17.7% 0.0% 0.0% 0.0% 2.09sec 154128 14.29sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.47sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath1 272156 19742 1465 31.30 2389 4778 7.0 7.0 17.6% 0.0% 0.0% 0.0% 17.35sec 19742 13.47sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath2 272156 19704 1462 31.30 2389 4778 7.0 7.0 17.3% 0.0% 0.0% 0.0% 17.35sec 19704 13.47sec
DL_GF_Felguard DL_GF_Felguard_void_terror melee 0 33436 2482 190.17 665 1329 42.7 42.7 17.8% 0.0% 0.0% 0.0% 2.67sec 47800 13.47sec
DL_GF_Felguard DL_GF_Felguard_urzul many_faced_bite 272439 19866 1597 45.44 1791 3585 9.4 9.4 17.7% 0.0% 0.0% 0.0% 12.55sec 28401 12.44sec
DL_GF_Felguard DL_GF_Felguard_urzul melee 0 33073 2659 204.23 665 1329 42.3 42.3 17.6% 0.0% 0.0% 0.0% 2.70sec 47282 12.44sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr melee 0 16742 1139 174.55 332 665 42.8 42.8 17.8% 0.0% 0.0% 0.0% 2.70sec 23934 14.70sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr melee_oh 0 8359 569 174.55 166 332 42.8 42.8 17.6% 0.0% 0.0% 0.0% 2.70sec 11950 14.70sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr shadow_slash 272012 25875 1760 37.39 2394 4789 9.2 9.2 18.0% 0.0% 0.0% 0.0% 12.96sec 25875 14.70sec
DL_GF_Felguard DL_GF_Felguard_darkhound fel_bite 272435 18467 1640 46.64 1796 3589 8.8 8.8 17.5% 0.0% 0.0% 0.0% 13.08sec 26401 11.26sec
DL_GF_Felguard DL_GF_Felguard_darkhound melee 0 32765 2910 223.31 665 1330 41.9 41.9 17.6% 0.0% 0.0% 0.0% 2.64sec 46841 11.26sec
DL_GF_Felguard DL_GF_Felguard_prince_malchezaar melee 0 77434 4023 65.57 3153 6294 21.0 21.0 16.8% 0.0% 0.0% 0.0% 1.56sec 110701 19.25sec
DL_GF_Felguard DL_GF_Felguard_prince_malchezaar melee_oh 0 39070 2030 65.57 1576 3151 21.0 21.0 17.9% 0.0% 0.0% 0.0% 1.56sec 55855 19.25sec
DL_GF_Imp DL_GF_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Imp DL_GF_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.37sec 0 300.01sec
DL_GF_Imp DL_GF_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 300.01sec
DL_GF_Imp DL_GF_Imp demonbolt 264178 376821 1256 9.00 7110 14220 44.2 45.0 17.7% 0.0% 0.0% 0.0% 6.20sec 376821 300.01sec
DL_GF_Imp DL_GF_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Imp DL_GF_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Imp DL_GF_Imp grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.74sec 0 300.01sec
DL_GF_Imp DL_GF_Imp hand_of_guldan 105174 315781 1053 12.06 4451 8886 60.4 60.3 17.7% 0.0% 0.0% 0.0% 4.90sec 315781 300.01sec
DL_GF_Imp DL_GF_Imp heed_my_call 271685 42317 141 1.46 4925 9849 7.3 7.3 17.9% 0.0% 0.0% 0.0% 37.06sec 42317 300.01sec
DL_GF_Imp DL_GF_Imp heed_my_call_aoe 271686 18152 61 1.46 2111 4221 7.3 7.3 18.0% 0.0% 0.0% 0.0% 37.06sec 18152 300.01sec
DL_GF_Imp DL_GF_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Imp DL_GF_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Imp DL_GF_Imp shadow_bolt 686 402042 1340 19.01 3595 7188 95.7 95.1 17.7% 0.0% 0.0% 0.0% 3.06sec 402042 300.01sec
DL_GF_Imp DL_GF_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.53sec 0 300.01sec
DL_GF_Imp DL_GF_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_GF_Imp DL_GF_Imp summon_random_demon 0 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 14.69sec 0 300.01sec
DL_GF_Imp DL_GF_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.22sec 0 300.01sec
DL_GF_Imp DL_GF_Imp volatile_blood_explosion 278057 87241 291 1.45 10240 20481 7.3 7.2 17.8% 0.0% 0.0% 0.0% 37.02sec 87241 300.01sec
DL_GF_Imp DL_GF_Imp_imp firebolt 3110 941765 3139 20.61 7775 15550 103.9 103.0 17.6% 0.0% 0.0% 0.0% 2.89sec 941765 300.01sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.17sec 0 64.40sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard felstorm ticks -89751 41966 140 3.89 1829 3661 3.9 19.5 17.8% 0.0% 0.0% 0.0% 80.55sec 59995 64.40sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard legion_strike 30213 118968 1847 17.19 5476 10960 18.4 18.4 17.7% 0.0% 0.0% 0.0% 13.90sec 170079 64.40sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard melee 0 145646 2261 38.14 3020 6043 40.9 40.9 17.8% 0.0% 0.0% 0.0% 6.36sec 208218 64.40sec
DL_GF_Imp DL_GF_Imp_illidari_satyr melee 0 16698 1328 203.72 332 664 42.7 42.7 17.7% 0.0% 0.0% 0.0% 2.53sec 23871 12.57sec
DL_GF_Imp DL_GF_Imp_illidari_satyr melee_oh 0 8340 663 203.72 166 332 42.7 42.7 17.6% 0.0% 0.0% 0.0% 2.53sec 11923 12.57sec
DL_GF_Imp DL_GF_Imp_illidari_satyr shadow_slash 272012 25808 2053 43.66 2395 4790 9.1 9.1 17.8% 0.0% 0.0% 0.0% 12.10sec 25808 12.57sec
DL_GF_Imp DL_GF_Imp_vilefiend bile_spit 267997 71043 499 2.86 8926 17844 6.8 6.8 17.6% 0.0% 0.0% 0.0% 47.22sec 164617 142.24sec
DL_GF_Imp DL_GF_Imp_vilefiend bile_spit ticks -267997 93573 312 6.63 2823 0 6.8 33.1 0.0% 0.0% 0.0% 0.0% 47.22sec 164617 142.24sec
DL_GF_Imp DL_GF_Imp_vilefiend headbutt 267999 104272 733 12.05 3106 6211 28.6 28.6 17.5% 0.0% 0.0% 0.0% 10.23sec 149070 142.24sec
DL_GF_Imp DL_GF_Imp_vilefiend melee 0 185439 1304 43.43 1531 3063 103.0 103.0 17.7% 0.0% 0.0% 0.0% 2.81sec 265108 142.24sec
DL_GF_Imp DL_GF_Imp_urzul many_faced_bite 272439 19818 1756 49.97 1793 3590 9.4 9.4 17.6% 0.0% 0.0% 0.0% 11.98sec 28332 11.28sec
DL_GF_Imp DL_GF_Imp_urzul melee 0 33235 2945 225.64 665 1330 42.4 42.4 17.8% 0.0% 0.0% 0.0% 2.59sec 47513 11.28sec
DL_GF_Imp DL_GF_Imp_dreadstalker dreadbite 205196 264326 2431 16.06 7717 15440 29.1 29.1 17.7% 0.0% 0.0% 0.0% 20.93sec 264326 108.72sec
DL_GF_Imp DL_GF_Imp_dreadstalker melee 0 457503 4208 172.49 1244 2488 312.6 312.6 17.7% 0.0% 0.0% 0.0% 1.89sec 654056 108.72sec
DL_GF_Imp DL_GF_Imp_wild_imp fel_firebolt 104318 742846 8633 690.99 637 1274 995.0 990.9 17.7% 0.0% 0.0% 0.0% 0.29sec 742846 86.05sec
DL_GF_Imp DL_GF_Imp_demonic_tyrant demonfire 270481 246514 4643 42.57 5561 11122 37.7 37.7 17.7% 0.0% 0.0% 0.0% 6.94sec 246514 53.09sec
DL_GF_Imp DL_GF_Imp_wrathguard melee 0 33367 2804 214.93 665 1330 42.6 42.6 17.7% 0.0% 0.0% 0.0% 2.57sec 47703 11.90sec
DL_GF_Imp DL_GF_Imp_wrathguard melee_oh 0 16689 1402 214.93 332 665 42.6 42.6 17.8% 0.0% 0.0% 0.0% 2.57sec 23859 11.90sec
DL_GF_Imp DL_GF_Imp_wrathguard overhead_assault 272432 18824 1582 44.89 1795 3588 8.9 8.9 17.8% 0.0% 0.0% 0.0% 12.75sec 26912 11.90sec
DL_GF_Imp DL_GF_Imp_shivarra melee 0 33552 2665 204.41 665 1330 42.9 42.9 17.6% 0.0% 0.0% 0.0% 2.62sec 47966 12.59sec
DL_GF_Imp DL_GF_Imp_shivarra melee_oh 0 16781 1333 204.41 332 665 42.9 42.9 17.7% 0.0% 0.0% 0.0% 2.62sec 23990 12.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 12.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash1 272172 6860 545 32.95 844 1690 6.9 6.9 17.6% 0.0% 0.0% 0.0% 17.51sec 9807 12.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash2 272172 6834 543 32.95 844 1688 6.9 6.9 17.1% 0.0% 0.0% 0.0% 17.51sec 9770 12.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash3 272172 6848 544 32.95 844 1688 6.9 6.9 17.4% 0.0% 0.0% 0.0% 17.51sec 9790 12.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash4 272172 6869 546 32.95 844 1686 6.9 6.9 17.8% 0.0% 0.0% 0.0% 17.51sec 9820 12.59sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.17sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath1 272156 19797 1504 32.03 2388 4778 7.0 7.0 17.9% 0.0% 0.0% 0.0% 16.75sec 19797 13.17sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath2 272156 19748 1500 32.03 2388 4780 7.0 7.0 17.6% 0.0% 0.0% 0.0% 16.75sec 19748 13.17sec
DL_GF_Imp DL_GF_Imp_void_terror melee 0 33437 2539 194.68 665 1329 42.7 42.7 17.8% 0.0% 0.0% 0.0% 2.59sec 47802 13.17sec
DL_GF_Imp DL_GF_Imp_vicious_hellhound demon_fangs 272013 26188 2134 45.43 2394 4786 9.3 9.3 17.7% 0.0% 0.0% 0.0% 12.48sec 26188 12.27sec
DL_GF_Imp DL_GF_Imp_vicious_hellhound melee 0 16160 1317 403.06 167 333 82.4 82.4 17.7% 0.0% 0.0% 0.0% 1.35sec 23103 12.27sec
DL_GF_Imp DL_GF_Imp_bilescourge toxic_bile 272167 155897 11203 238.12 2400 4796 55.2 55.2 17.6% 0.0% 0.0% 0.0% 1.99sec 155897 13.92sec
DL_GF_Imp DL_GF_Imp_darkhound fel_bite 272435 18706 1564 44.40 1795 3592 8.8 8.8 17.7% 0.0% 0.0% 0.0% 13.20sec 26743 11.96sec
DL_GF_Imp DL_GF_Imp_darkhound melee 0 33177 2774 212.78 665 1329 42.4 42.4 17.7% 0.0% 0.0% 0.0% 2.67sec 47431 11.96sec
DL_GF_Imp DL_GF_Imp_prince_malchezaar melee 0 79526 5547 89.53 3148 6290 21.4 21.4 18.1% 0.0% 0.0% 0.0% 1.42sec 113693 14.34sec
DL_GF_Imp DL_GF_Imp_prince_malchezaar melee_oh 0 39597 2762 89.53 1573 3152 21.4 21.4 17.6% 0.0% 0.0% 0.0% 1.42sec 56608 14.34sec
DL_GF_Imp DL_GF_Imp_eye_of_guldan eye_of_guldan ticks -272131 24540 82 12.26 400 0 28.2 61.3 0.0% 0.0% 0.0% 0.0% 4.36sec 24540 15.80sec
DL_ID_Felguard DL_ID_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.94sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.04sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard demonbolt 264178 402002 1340 9.60 7113 14234 47.2 48.0 17.7% 0.0% 0.0% 0.0% 5.79sec 402002 300.01sec
DL_ID_Felguard DL_ID_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard hand_of_guldan 105174 329756 1099 12.56 4464 8927 62.9 62.8 17.7% 0.0% 0.0% 0.0% 4.72sec 329756 300.01sec
DL_ID_Felguard DL_ID_Felguard heed_my_call 271685 42083 140 1.46 4925 9849 7.3 7.3 17.2% 0.0% 0.0% 0.0% 36.85sec 42083 300.01sec
DL_ID_Felguard DL_ID_Felguard heed_my_call_aoe 271686 18091 60 1.46 2111 4221 7.3 7.3 17.6% 0.0% 0.0% 0.0% 36.85sec 18091 300.01sec
DL_ID_Felguard DL_ID_Felguard inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard shadow_bolt 686 394100 1314 18.63 3593 7186 93.8 93.2 17.7% 0.0% 0.0% 0.0% 3.14sec 394100 300.01sec
DL_ID_Felguard DL_ID_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.54sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.53sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.19sec 0 300.01sec
DL_ID_Felguard DL_ID_Felguard volatile_blood_explosion 278057 86348 288 1.44 10240 20481 7.3 7.2 17.4% 0.0% 0.0% 0.0% 36.71sec 86348 300.01sec
DL_ID_Felguard DL_ID_Felguard_felguard felstorm ticks -89751 113747 379 12.42 1556 3112 10.4 62.1 17.7% 0.0% 0.0% 0.0% 30.14sec 162615 300.01sec
DL_ID_Felguard DL_ID_Felguard_felguard legion_strike 30213 317921 1060 11.68 4626 9256 58.4 58.4 17.7% 0.0% 0.0% 0.0% 5.10sec 454506 300.01sec
DL_ID_Felguard DL_ID_Felguard_felguard melee 0 516404 1721 34.72 2528 5054 173.6 173.6 17.7% 0.0% 0.0% 0.0% 1.71sec 738262 300.01sec
DL_ID_Felguard DL_ID_Felguard_urzul many_faced_bite 272439 22301 1558 44.78 1777 3557 10.7 10.7 17.4% 0.0% 0.0% 0.0% 12.50sec 31882 14.31sec
DL_ID_Felguard DL_ID_Felguard_urzul melee 0 36824 2573 199.10 660 1319 47.5 47.5 17.6% 0.0% 0.0% 0.0% 2.74sec 52645 14.31sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 14.65sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath1 272156 21989 1501 32.29 2367 4737 7.9 7.9 17.8% 0.0% 0.0% 0.0% 17.37sec 21989 14.65sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath2 272156 21969 1500 32.29 2367 4735 7.9 7.9 17.7% 0.0% 0.0% 0.0% 17.37sec 21969 14.65sec
DL_ID_Felguard DL_ID_Felguard_void_terror melee 0 36705 2506 193.65 660 1319 47.3 47.3 17.7% 0.0% 0.0% 0.0% 2.72sec 52474 14.65sec
DL_ID_Felguard DL_ID_Felguard_vilefiend bile_spit 267997 70912 473 2.73 8824 17649 6.8 6.8 17.6% 0.0% 0.0% 0.0% 47.19sec 163772 149.86sec
DL_ID_Felguard DL_ID_Felguard_vilefiend bile_spit ticks -267997 92860 310 6.69 2777 0 6.8 33.4 0.0% 0.0% 0.0% 0.0% 47.19sec 163772 149.86sec
DL_ID_Felguard DL_ID_Felguard_vilefiend headbutt 267999 109968 734 12.05 3100 6200 30.1 30.1 17.9% 0.0% 0.0% 0.0% 9.83sec 157213 149.86sec
DL_ID_Felguard DL_ID_Felguard_vilefiend melee 0 193508 1291 43.16 1526 3052 107.8 107.8 17.6% 0.0% 0.0% 0.0% 2.72sec 276642 149.86sec
DL_ID_Felguard DL_ID_Felguard_dreadstalker dreadbite 205196 263898 2437 16.11 7720 15428 29.1 29.1 17.6% 0.0% 0.0% 0.0% 21.04sec 263898 108.27sec
DL_ID_Felguard DL_ID_Felguard_dreadstalker melee 0 456056 4212 172.82 1243 2484 311.9 311.9 17.7% 0.0% 0.0% 0.0% 1.90sec 651987 108.27sec
DL_ID_Felguard DL_ID_Felguard_wild_imp fel_firebolt 104318 913117 10313 822.15 640 1279 1218.2 1213.2 17.7% 0.0% 0.0% 0.0% 0.24sec 913117 88.54sec
DL_ID_Felguard DL_ID_Felguard_wrathguard melee 0 36973 3515 271.82 660 1319 47.7 47.7 17.6% 0.0% 0.0% 0.0% 2.72sec 52857 10.52sec
DL_ID_Felguard DL_ID_Felguard_wrathguard melee_oh 0 18487 1758 271.82 330 660 47.7 47.7 17.6% 0.0% 0.0% 0.0% 2.72sec 26430 10.52sec
DL_ID_Felguard DL_ID_Felguard_wrathguard overhead_assault 272432 21135 2009 57.54 1780 3556 10.1 10.1 17.7% 0.0% 0.0% 0.0% 13.24sec 30215 10.52sec
DL_ID_Felguard DL_ID_Felguard_demonic_tyrant demonfire 270481 245746 4648 42.64 5562 11123 37.7 37.6 17.6% 0.0% 0.0% 0.0% 6.89sec 245746 52.88sec
DL_ID_Felguard DL_ID_Felguard_bilescourge toxic_bile 272167 170049 11886 254.32 2383 4767 60.7 60.6 17.7% 0.0% 0.0% 0.0% 2.06sec 170049 14.31sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr melee 0 18114 1259 194.54 330 659 46.6 46.6 17.8% 0.0% 0.0% 0.0% 2.67sec 25896 14.39sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr melee_oh 0 9051 629 194.54 165 330 46.6 46.6 17.7% 0.0% 0.0% 0.0% 2.67sec 12939 14.39sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr shadow_slash 272012 28223 1962 42.08 2376 4751 10.1 10.1 17.7% 0.0% 0.0% 0.0% 12.59sec 28223 14.39sec
DL_ID_Felguard DL_ID_Felguard_shivarra melee 0 36933 2798 216.36 659 1319 47.6 47.6 17.7% 0.0% 0.0% 0.0% 2.74sec 52801 13.20sec
DL_ID_Felguard DL_ID_Felguard_shivarra melee_oh 0 18486 1400 216.36 330 660 47.6 47.6 17.8% 0.0% 0.0% 0.0% 2.74sec 26428 13.20sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.20sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash1 272172 7659 580 35.36 835 1669 7.8 7.8 17.9% 0.0% 0.0% 0.0% 17.83sec 10949 13.20sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash2 272172 7666 581 35.36 835 1670 7.8 7.8 18.0% 0.0% 0.0% 0.0% 17.83sec 10960 13.20sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash3 272172 7643 579 35.36 835 1673 7.8 7.8 17.6% 0.0% 0.0% 0.0% 17.83sec 10926 13.20sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash4 272172 7652 580 35.36 835 1673 7.8 7.8 17.7% 0.0% 0.0% 0.0% 17.83sec 10940 13.20sec
DL_ID_Felguard DL_ID_Felguard_darkhound fel_bite 272435 20952 1500 42.96 1779 3555 10.0 10.0 17.8% 0.0% 0.0% 0.0% 13.33sec 29953 13.97sec
DL_ID_Felguard DL_ID_Felguard_darkhound melee 0 36675 2625 202.90 660 1319 47.2 47.2 17.7% 0.0% 0.0% 0.0% 2.76sec 52432 13.97sec
DL_ID_Felguard DL_ID_Felguard_vicious_hellhound demon_fangs 272013 28861 2546 54.70 2373 4750 10.3 10.3 17.6% 0.0% 0.0% 0.0% 12.61sec 28861 11.34sec
DL_ID_Felguard DL_ID_Felguard_vicious_hellhound melee 0 17572 1550 478.03 165 331 90.3 90.3 17.7% 0.0% 0.0% 0.0% 1.40sec 25121 11.34sec
DL_ID_Felguard DL_ID_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24581 82 12.31 399 0 28.5 61.6 0.0% 0.0% 0.0% 0.0% 4.66sec 24581 11.94sec
DL_ID_Felguard DL_ID_Felguard_prince_malchezaar melee 0 79676 6847 111.92 3123 6253 21.7 21.7 17.5% 0.0% 0.0% 0.0% 1.69sec 113906 11.64sec
DL_ID_Felguard DL_ID_Felguard_prince_malchezaar melee_oh 0 39807 3421 111.92 1562 3118 21.7 21.7 17.4% 0.0% 0.0% 0.0% 1.69sec 56908 11.64sec
DL_ID_Imp DL_ID_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Imp DL_ID_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.87sec 0 300.01sec
DL_ID_Imp DL_ID_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.05sec 0 300.01sec
DL_ID_Imp DL_ID_Imp demonbolt 264178 400486 1335 9.57 7115 14226 47.0 47.9 17.6% 0.0% 0.0% 0.0% 5.81sec 400486 300.01sec
DL_ID_Imp DL_ID_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Imp DL_ID_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Imp DL_ID_Imp hand_of_guldan 105174 329515 1098 12.55 4463 8915 62.9 62.8 17.7% 0.0% 0.0% 0.0% 4.72sec 329515 300.01sec
DL_ID_Imp DL_ID_Imp heed_my_call 271685 42354 141 1.46 4925 9849 7.3 7.3 18.0% 0.0% 0.0% 0.0% 37.76sec 42354 300.01sec
DL_ID_Imp DL_ID_Imp heed_my_call_aoe 271686 18116 60 1.46 2111 4221 7.3 7.3 17.8% 0.0% 0.0% 0.0% 37.76sec 18116 300.01sec
DL_ID_Imp DL_ID_Imp inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Imp DL_ID_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Imp DL_ID_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Imp DL_ID_Imp shadow_bolt 686 394942 1316 18.67 3593 7186 94.0 93.3 17.8% 0.0% 0.0% 0.0% 3.13sec 394942 300.01sec
DL_ID_Imp DL_ID_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.50sec 0 300.01sec
DL_ID_Imp DL_ID_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DL_ID_Imp DL_ID_Imp summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.68sec 0 300.01sec
DL_ID_Imp DL_ID_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.18sec 0 300.01sec
DL_ID_Imp DL_ID_Imp volatile_blood_explosion 278057 87438 291 1.45 10240 20481 7.3 7.2 17.9% 0.0% 0.0% 0.0% 37.21sec 87438 300.01sec
DL_ID_Imp DL_ID_Imp_imp firebolt 3110 940180 3134 20.60 7760 15511 103.8 103.0 17.6% 0.0% 0.0% 0.0% 2.89sec 940180 300.01sec
DL_ID_Imp DL_ID_Imp_darkhound fel_bite 272435 21077 1620 46.41 1780 3556 10.1 10.1 17.7% 0.0% 0.0% 0.0% 12.92sec 30132 13.01sec
DL_ID_Imp DL_ID_Imp_darkhound melee 0 36950 2841 219.62 660 1320 47.6 47.6 17.6% 0.0% 0.0% 0.0% 2.66sec 52825 13.01sec
DL_ID_Imp DL_ID_Imp_illidari_satyr melee 0 18556 1426 220.53 330 660 47.8 47.8 17.6% 0.0% 0.0% 0.0% 2.78sec 26528 13.01sec
DL_ID_Imp DL_ID_Imp_illidari_satyr melee_oh 0 9285 714 220.53 165 330 47.8 47.8 17.7% 0.0% 0.0% 0.0% 2.78sec 13274 13.01sec
DL_ID_Imp DL_ID_Imp_illidari_satyr shadow_slash 272012 28893 2220 47.65 2376 4751 10.3 10.3 17.7% 0.0% 0.0% 0.0% 13.16sec 28893 13.01sec
DL_ID_Imp DL_ID_Imp_vilefiend bile_spit 267997 70927 473 2.73 8825 17640 6.8 6.8 17.7% 0.0% 0.0% 0.0% 47.18sec 163803 149.85sec
DL_ID_Imp DL_ID_Imp_vilefiend bile_spit ticks -267997 92876 310 6.69 2778 0 6.8 33.4 0.0% 0.0% 0.0% 0.0% 47.18sec 163803 149.85sec
DL_ID_Imp DL_ID_Imp_vilefiend headbutt 267999 109873 733 12.05 3100 6200 30.1 30.1 17.8% 0.0% 0.0% 0.0% 9.82sec 157077 149.85sec
DL_ID_Imp DL_ID_Imp_vilefiend melee 0 193748 1293 43.18 1526 3051 107.8 107.8 17.8% 0.0% 0.0% 0.0% 2.71sec 276986 149.85sec
DL_ID_Imp DL_ID_Imp_vicious_hellhound demon_fangs 272013 29318 2476 53.26 2373 4749 10.5 10.5 17.5% 0.0% 0.0% 0.0% 12.37sec 29318 11.84sec
DL_ID_Imp DL_ID_Imp_vicious_hellhound melee 0 17871 1509 465.84 165 330 91.9 91.9 17.6% 0.0% 0.0% 0.0% 1.38sec 25548 11.84sec
DL_ID_Imp DL_ID_Imp_dreadstalker dreadbite 205196 264396 2458 16.20 7721 15437 29.0 29.0 17.9% 0.0% 0.0% 0.0% 21.05sec 264396 107.56sec
DL_ID_Imp DL_ID_Imp_dreadstalker melee 0 455160 4232 173.67 1243 2485 311.3 311.3 17.7% 0.0% 0.0% 0.0% 1.90sec 650706 107.56sec
DL_ID_Imp DL_ID_Imp_urzul many_faced_bite 272439 22113 1550 44.59 1778 3554 10.6 10.6 17.3% 0.0% 0.0% 0.0% 12.29sec 31613 14.27sec
DL_ID_Imp DL_ID_Imp_urzul melee 0 36660 2569 198.28 660 1320 47.2 47.2 17.9% 0.0% 0.0% 0.0% 2.69sec 52410 14.27sec
DL_ID_Imp DL_ID_Imp_wild_imp fel_firebolt 104318 912937 9216 734.51 640 1279 1217.5 1212.6 17.7% 0.0% 0.0% 0.0% 0.24sec 912937 99.06sec
DL_ID_Imp DL_ID_Imp_demonic_tyrant demonfire 270481 245755 4648 42.63 5561 11121 37.6 37.6 17.6% 0.0% 0.0% 0.0% 6.89sec 245755 52.87sec
DL_ID_Imp DL_ID_Imp_wrathguard melee 0 36577 2644 204.17 660 1319 47.1 47.1 17.8% 0.0% 0.0% 0.0% 2.68sec 52291 13.84sec
DL_ID_Imp DL_ID_Imp_wrathguard melee_oh 0 18273 1321 204.17 330 660 47.1 47.1 17.7% 0.0% 0.0% 0.0% 2.68sec 26124 13.84sec
DL_ID_Imp DL_ID_Imp_wrathguard overhead_assault 272432 20855 1507 43.18 1780 3560 10.0 10.0 17.7% 0.0% 0.0% 0.0% 13.00sec 29814 13.84sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 9.60sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath1 272156 21750 2265 48.85 2367 4734 7.8 7.8 17.5% 0.0% 0.0% 0.0% 17.63sec 21750 9.60sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath2 272156 21798 2269 48.85 2367 4731 7.8 7.8 17.8% 0.0% 0.0% 0.0% 17.63sec 21798 9.60sec
DL_ID_Imp DL_ID_Imp_void_terror melee 0 36350 3785 292.27 660 1318 46.8 46.8 17.8% 0.0% 0.0% 0.0% 2.78sec 51967 9.60sec
DL_ID_Imp DL_ID_Imp_shivarra melee 0 36709 2576 199.06 659 1319 47.3 47.3 17.7% 0.0% 0.0% 0.0% 2.66sec 52480 14.25sec
DL_ID_Imp DL_ID_Imp_shivarra melee_oh 0 18311 1285 199.06 330 660 47.3 47.3 17.5% 0.0% 0.0% 0.0% 2.66sec 26178 14.25sec
DL_ID_Imp DL_ID_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 14.25sec
DL_ID_Imp DL_ID_Imp_shivarra multislash1 272172 7564 531 32.54 835 1674 7.7 7.7 17.1% 0.0% 0.0% 0.0% 17.29sec 10813 14.25sec
DL_ID_Imp DL_ID_Imp_shivarra multislash2 272172 7607 534 32.54 835 1672 7.7 7.7 17.8% 0.0% 0.0% 0.0% 17.29sec 10876 14.25sec
DL_ID_Imp DL_ID_Imp_shivarra multislash3 272172 7594 533 32.54 835 1673 7.7 7.7 17.6% 0.0% 0.0% 0.0% 17.29sec 10857 14.25sec
DL_ID_Imp DL_ID_Imp_shivarra multislash4 272172 7610 534 32.54 835 1671 7.7 7.7 17.9% 0.0% 0.0% 0.0% 17.29sec 10880 14.25sec
DL_ID_Imp DL_ID_Imp_bilescourge toxic_bile 272167 169924 17306 370.48 2382 4765 60.7 60.6 17.6% 0.0% 0.0% 0.0% 2.12sec 169924 9.82sec
DL_ID_Imp DL_ID_Imp_eye_of_guldan eye_of_guldan ticks -272131 24815 83 12.42 400 0 28.8 62.1 0.0% 0.0% 0.0% 0.0% 5.03sec 24815 14.43sec
DL_ID_Imp DL_ID_Imp_prince_malchezaar melee 0 76660 5196 84.54 3122 6239 20.8 20.8 18.1% 0.0% 0.0% 0.0% 1.57sec 109595 14.75sec
DL_ID_Imp DL_ID_Imp_prince_malchezaar melee_oh 0 38206 2590 84.54 1561 3117 20.8 20.8 17.8% 0.0% 0.0% 0.0% 1.57sec 54621 14.75sec
DStr_GF_Felguard DStr_GF_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.59sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 20.96sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard demonbolt 264178 370465 1235 8.87 7098 14205 43.5 44.4 17.7% 0.0% 0.0% 0.0% 6.28sec 370465 300.01sec
DStr_GF_Felguard DStr_GF_Felguard demonic_strength 267171 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.47sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.76sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard hand_of_guldan 105174 307442 1025 11.83 4419 8828 59.3 59.1 17.7% 0.0% 0.0% 0.0% 4.97sec 307442 300.01sec
DStr_GF_Felguard DStr_GF_Felguard heed_my_call 271685 42416 141 1.46 4925 9849 7.3 7.3 17.8% 0.0% 0.0% 0.0% 37.13sec 42416 300.01sec
DStr_GF_Felguard DStr_GF_Felguard heed_my_call_aoe 271686 18140 60 1.46 2111 4221 7.3 7.3 17.6% 0.0% 0.0% 0.0% 37.13sec 18140 300.01sec
DStr_GF_Felguard DStr_GF_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.43sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard shadow_bolt 686 390294 1301 18.46 3593 7182 93.0 92.3 17.7% 0.0% 0.0% 0.0% 3.14sec 390294 300.01sec
DStr_GF_Felguard DStr_GF_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.66sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard summon_random_demon 0 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 13.87sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 47.37sec 0 300.01sec
DStr_GF_Felguard DStr_GF_Felguard volatile_blood_explosion 278057 86875 290 1.44 10240 20481 7.3 7.2 17.7% 0.0% 0.0% 0.0% 36.52sec 86875 300.01sec
DStr_GF_Felguard DStr_GF_Felguard_felguard demonic_strength_felstorm ticks -89751 237518 792 6.47 6241 12482 5.4 32.4 17.6% 0.0% 0.0% 0.0% 60.70sec 339561 300.01sec
DStr_GF_Felguard DStr_GF_Felguard_felguard felstorm ticks -89751 110180 367 12.12 1546 3091 10.2 60.6 17.6% 0.0% 0.0% 0.0% 30.59sec 157515 300.01sec
DStr_GF_Felguard DStr_GF_Felguard_felguard legion_strike 30213 291160 970 10.64 4648 9294 53.2 53.2 17.7% 0.0% 0.0% 0.0% 5.53sec 416248 300.01sec
DStr_GF_Felguard DStr_GF_Felguard_felguard melee 0 480565 1602 32.22 2534 5069 161.1 161.1 17.7% 0.0% 0.0% 0.0% 1.82sec 687025 300.01sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.09sec 0 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard felstorm ticks -89751 41830 139 3.88 1832 3663 3.9 19.4 17.6% 0.0% 0.0% 0.0% 80.80sec 59801 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard legion_strike 30213 118695 1847 17.21 5470 10949 18.4 18.4 17.7% 0.0% 0.0% 0.0% 13.86sec 169689 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard melee 0 145319 2261 38.23 3018 6032 40.9 40.9 17.6% 0.0% 0.0% 0.0% 6.33sec 207752 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr melee 0 16433 2228 342.35 332 664 42.1 42.1 17.7% 0.0% 0.0% 0.0% 2.74sec 23493 7.38sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr melee_oh 0 8212 1113 342.35 166 332 42.1 42.1 17.6% 0.0% 0.0% 0.0% 2.74sec 11740 7.38sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr shadow_slash 272012 25382 3440 73.06 2394 4786 9.0 9.0 18.1% 0.0% 0.0% 0.0% 13.21sec 25382 7.38sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard melee 0 33124 3253 249.92 664 1328 42.4 42.4 17.6% 0.0% 0.0% 0.0% 2.70sec 47355 10.18sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard melee_oh 0 16555 1626 249.92 332 664 42.4 42.4 17.6% 0.0% 0.0% 0.0% 2.70sec 23667 10.18sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard overhead_assault 272432 18692 1836 52.14 1793 3590 8.8 8.8 17.8% 0.0% 0.0% 0.0% 13.35sec 26722 10.18sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend bile_spit 267997 70440 494 2.83 8908 17810 6.7 6.7 17.6% 0.0% 0.0% 0.0% 47.37sec 163311 142.66sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend bile_spit ticks -267997 92871 310 6.59 2820 0 6.7 32.9 0.0% 0.0% 0.0% 0.0% 47.37sec 163311 142.66sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend headbutt 267999 104740 734 12.05 3108 6214 28.6 28.6 17.7% 0.0% 0.0% 0.0% 10.20sec 149738 142.66sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend melee 0 185727 1302 43.41 1529 3060 103.2 103.2 17.7% 0.0% 0.0% 0.0% 2.80sec 265519 142.66sec
DStr_GF_Felguard DStr_GF_Felguard_darkhound fel_bite 272435 18535 2457 69.93 1794 3587 8.8 8.8 17.5% 0.0% 0.0% 0.0% 12.98sec 26498 7.54sec
DStr_GF_Felguard DStr_GF_Felguard_darkhound melee 0 32884 4359 335.02 664 1328 42.1 42.1 17.6% 0.0% 0.0% 0.0% 2.61sec 47011 7.54sec
DStr_GF_Felguard DStr_GF_Felguard_dreadstalker dreadbite 205196 210855 1950 16.09 6173 12352 29.0 29.0 17.8% 0.0% 0.0% 0.0% 20.96sec 210855 108.14sec
DStr_GF_Felguard DStr_GF_Felguard_dreadstalker melee 0 456659 4223 173.12 1243 2487 312.0 312.0 17.7% 0.0% 0.0% 0.0% 1.89sec 652849 108.14sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra melee 0 33294 3535 271.53 664 1328 42.6 42.6 17.7% 0.0% 0.0% 0.0% 2.65sec 47598 9.42sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra melee_oh 0 16664 1769 271.53 332 664 42.6 42.6 17.8% 0.0% 0.0% 0.0% 2.65sec 23823 9.42sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 9.42sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash1 272172 6794 721 43.63 843 1687 6.8 6.8 17.7% 0.0% 0.0% 0.0% 17.84sec 9713 9.42sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash2 272172 6814 724 43.63 843 1686 6.8 6.8 18.0% 0.0% 0.0% 0.0% 17.84sec 9741 9.42sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash3 272172 6817 724 43.63 843 1685 6.8 6.8 18.1% 0.0% 0.0% 0.0% 17.84sec 9746 9.42sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash4 272172 6824 725 43.63 843 1687 6.8 6.8 18.2% 0.0% 0.0% 0.0% 17.84sec 9756 9.42sec
DStr_GF_Felguard DStr_GF_Felguard_wild_imp fel_firebolt 104318 729989 8459 676.77 637 1274 977.4 973.4 17.7% 0.0% 0.0% 0.0% 0.30sec 729989 86.30sec
DStr_GF_Felguard DStr_GF_Felguard_demonic_tyrant demonfire 270481 245545 4643 42.62 5562 11121 37.7 37.6 17.5% 0.0% 0.0% 0.0% 6.91sec 245545 52.89sec
DStr_GF_Felguard DStr_GF_Felguard_vicious_hellhound demon_fangs 272013 26562 2267 48.36 2392 4783 9.4 9.4 17.6% 0.0% 0.0% 0.0% 12.26sec 26562 11.71sec
DStr_GF_Felguard DStr_GF_Felguard_vicious_hellhound melee 0 16470 1406 430.96 166 333 84.1 84.1 17.7% 0.0% 0.0% 0.0% 1.32sec 23545 11.71sec
DStr_GF_Felguard DStr_GF_Felguard_urzul many_faced_bite 272439 19964 1387 39.37 1792 3580 9.4 9.4 18.0% 0.0% 0.0% 0.0% 12.16sec 28541 14.39sec
DStr_GF_Felguard DStr_GF_Felguard_urzul melee 0 33430 2322 178.25 664 1328 42.8 42.8 17.8% 0.0% 0.0% 0.0% 2.59sec 47792 14.39sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.28sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath1 272156 19822 1492 31.89 2384 4774 7.1 7.1 17.7% 0.0% 0.0% 0.0% 17.91sec 19822 13.28sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath2 272156 19801 1491 31.89 2384 4773 7.1 7.1 17.6% 0.0% 0.0% 0.0% 17.91sec 19801 13.28sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror melee 0 33556 2526 194.08 664 1327 43.0 43.0 17.7% 0.0% 0.0% 0.0% 2.74sec 47972 13.28sec
DStr_GF_Felguard DStr_GF_Felguard_bilescourge toxic_bile 272167 155356 21933 466.08 2397 4796 55.0 55.0 17.8% 0.0% 0.0% 0.0% 2.02sec 155356 7.08sec
DStr_GF_Felguard DStr_GF_Felguard_prince_malchezaar melee 0 76632 7483 120.96 3145 6280 20.6 20.6 18.1% 0.0% 0.0% 0.0% 1.77sec 109555 10.24sec
DStr_GF_Felguard DStr_GF_Felguard_prince_malchezaar melee_oh 0 38207 3731 120.96 1572 3146 20.6 20.6 17.7% 0.0% 0.0% 0.0% 1.77sec 54622 10.24sec
DStr_GF_Felguard DStr_GF_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24435 81 12.21 400 0 28.1 61.0 0.0% 0.0% 0.0% 0.0% 5.33sec 24435 16.83sec
DStr_GF_Imp DStr_GF_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.29sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp demonbolt 264178 376955 1256 9.02 7109 14215 44.2 45.1 17.6% 0.0% 0.0% 0.0% 6.21sec 376955 300.01sec
DStr_GF_Imp DStr_GF_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.74sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp hand_of_guldan 105174 315916 1053 12.07 4446 8908 60.5 60.3 17.7% 0.0% 0.0% 0.0% 4.89sec 315916 300.01sec
DStr_GF_Imp DStr_GF_Imp heed_my_call 271685 42176 141 1.45 4925 9849 7.3 7.3 18.0% 0.0% 0.0% 0.0% 36.67sec 42176 300.01sec
DStr_GF_Imp DStr_GF_Imp heed_my_call_aoe 271686 17982 60 1.45 2111 4221 7.3 7.3 17.4% 0.0% 0.0% 0.0% 36.67sec 17982 300.01sec
DStr_GF_Imp DStr_GF_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp shadow_bolt 686 401847 1339 19.00 3595 7190 95.7 95.0 17.7% 0.0% 0.0% 0.0% 3.06sec 401847 300.01sec
DStr_GF_Imp DStr_GF_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.50sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp summon_random_demon 0 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 14.66sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.23sec 0 300.01sec
DStr_GF_Imp DStr_GF_Imp volatile_blood_explosion 278057 86529 288 1.44 10240 20481 7.3 7.2 17.7% 0.0% 0.0% 0.0% 37.15sec 86529 300.01sec
DStr_GF_Imp DStr_GF_Imp_imp firebolt 3110 943213 3144 20.61 7775 15554 103.9 103.1 17.7% 0.0% 0.0% 0.0% 2.89sec 943213 300.01sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.20sec 0 64.41sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard felstorm ticks -89751 41908 140 3.89 1830 3660 3.9 19.5 17.7% 0.0% 0.0% 0.0% 80.76sec 59913 64.41sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard legion_strike 30213 119021 1848 17.19 5478 10958 18.5 18.5 17.7% 0.0% 0.0% 0.0% 13.88sec 170154 64.41sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard melee 0 145574 2260 38.15 3021 6040 41.0 41.0 17.7% 0.0% 0.0% 0.0% 6.35sec 208116 64.41sec
DStr_GF_Imp DStr_GF_Imp_bilescourge toxic_bile 272167 156096 11751 249.51 2401 4801 55.2 55.2 17.7% 0.0% 0.0% 0.0% 2.07sec 156096 13.28sec
DStr_GF_Imp DStr_GF_Imp_urzul many_faced_bite 272439 19787 1283 36.55 1793 3585 9.4 9.4 17.5% 0.0% 0.0% 0.0% 12.16sec 28288 15.42sec
DStr_GF_Imp DStr_GF_Imp_urzul melee 0 33089 2146 164.74 665 1330 42.3 42.3 17.5% 0.0% 0.0% 0.0% 2.61sec 47305 15.42sec
DStr_GF_Imp DStr_GF_Imp_vilefiend bile_spit 267997 71073 501 2.86 8927 17882 6.8 6.8 17.4% 0.0% 0.0% 0.0% 47.23sec 164704 142.00sec
DStr_GF_Imp DStr_GF_Imp_vilefiend bile_spit ticks -267997 93630 312 6.64 2821 0 6.8 33.2 0.0% 0.0% 0.0% 0.0% 47.23sec 164704 142.00sec
DStr_GF_Imp DStr_GF_Imp_vilefiend headbutt 267999 104179 734 12.05 3104 6217 28.5 28.5 17.6% 0.0% 0.0% 0.0% 10.28sec 148937 142.00sec
DStr_GF_Imp DStr_GF_Imp_vilefiend melee 0 185118 1304 43.45 1530 3061 102.8 102.8 17.6% 0.0% 0.0% 0.0% 2.82sec 264648 142.00sec
DStr_GF_Imp DStr_GF_Imp_dreadstalker dreadbite 205196 211586 1950 16.09 6176 12340 29.1 29.1 17.8% 0.0% 0.0% 0.0% 20.93sec 211586 108.50sec
DStr_GF_Imp DStr_GF_Imp_dreadstalker melee 0 457287 4215 172.73 1244 2489 312.3 312.3 17.7% 0.0% 0.0% 0.0% 1.89sec 653747 108.50sec
DStr_GF_Imp DStr_GF_Imp_darkhound fel_bite 272435 18870 1841 52.30 1795 3590 8.9 8.9 17.7% 0.0% 0.0% 0.0% 13.13sec 26977 10.25sec
DStr_GF_Imp DStr_GF_Imp_darkhound melee 0 33388 3258 250.30 665 1329 42.7 42.7 17.5% 0.0% 0.0% 0.0% 2.65sec 47733 10.25sec
DStr_GF_Imp DStr_GF_Imp_wild_imp fel_firebolt 104318 743578 8393 671.69 637 1274 996.0 991.9 17.7% 0.0% 0.0% 0.0% 0.29sec 743578 88.60sec
DStr_GF_Imp DStr_GF_Imp_demonic_tyrant demonfire 270481 246749 4648 42.59 5561 11122 37.8 37.7 17.7% 0.0% 0.0% 0.0% 6.91sec 246749 53.09sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 10.99sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath1 272156 19653 1788 38.21 2389 4782 7.0 7.0 17.5% 0.0% 0.0% 0.0% 17.06sec 19653 10.99sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath2 272156 19647 1788 38.21 2389 4776 7.0 7.0 17.5% 0.0% 0.0% 0.0% 17.06sec 19647 10.99sec
DStr_GF_Imp DStr_GF_Imp_void_terror melee 0 33224 3023 231.97 665 1329 42.5 42.5 17.6% 0.0% 0.0% 0.0% 2.62sec 47498 10.99sec
DStr_GF_Imp DStr_GF_Imp_vicious_hellhound demon_fangs 272013 26075 1979 42.11 2393 4787 9.3 9.3 17.8% 0.0% 0.0% 0.0% 12.34sec 26075 13.18sec
DStr_GF_Imp DStr_GF_Imp_vicious_hellhound melee 0 16043 1217 372.65 167 333 81.9 81.9 17.7% 0.0% 0.0% 0.0% 1.34sec 22935 13.18sec
DStr_GF_Imp DStr_GF_Imp_wrathguard melee 0 32900 2777 213.05 665 1330 42.1 42.1 17.6% 0.0% 0.0% 0.0% 2.68sec 47035 11.85sec
DStr_GF_Imp DStr_GF_Imp_wrathguard melee_oh 0 16481 1391 213.05 332 665 42.1 42.1 17.8% 0.0% 0.0% 0.0% 2.68sec 23562 11.85sec
DStr_GF_Imp DStr_GF_Imp_wrathguard overhead_assault 272432 18554 1566 44.41 1796 3591 8.8 8.8 17.8% 0.0% 0.0% 0.0% 13.35sec 26525 11.85sec
DStr_GF_Imp DStr_GF_Imp_shivarra melee 0 33054 2659 204.10 665 1329 42.3 42.3 17.6% 0.0% 0.0% 0.0% 2.70sec 47255 12.43sec
DStr_GF_Imp DStr_GF_Imp_shivarra melee_oh 0 16535 1330 204.10 332 665 42.3 42.3 17.7% 0.0% 0.0% 0.0% 2.70sec 23639 12.43sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 12.43sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash1 272172 6801 547 32.99 843 1689 6.8 6.8 17.9% 0.0% 0.0% 0.0% 18.01sec 9723 12.43sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash2 272172 6773 545 32.99 844 1687 6.8 6.8 17.5% 0.0% 0.0% 0.0% 18.01sec 9683 12.43sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash3 272172 6806 547 32.99 844 1686 6.8 6.8 18.1% 0.0% 0.0% 0.0% 18.01sec 9729 12.43sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash4 272172 6793 546 32.99 844 1687 6.8 6.8 17.8% 0.0% 0.0% 0.0% 18.01sec 9712 12.43sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr melee 0 16836 1318 202.13 332 665 43.0 43.0 17.7% 0.0% 0.0% 0.0% 2.66sec 24070 12.78sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr melee_oh 0 8409 658 202.13 166 332 43.0 43.0 17.6% 0.0% 0.0% 0.0% 2.66sec 12022 12.78sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr shadow_slash 272012 25997 2034 43.26 2395 4789 9.2 9.2 17.8% 0.0% 0.0% 0.0% 12.86sec 25997 12.78sec
DStr_GF_Imp DStr_GF_Imp_prince_malchezaar melee 0 79466 7574 123.48 3145 6306 21.6 21.6 16.9% 0.0% 0.0% 0.0% 1.31sec 113606 10.49sec
DStr_GF_Imp DStr_GF_Imp_prince_malchezaar melee_oh 0 39846 3798 123.48 1573 3147 21.6 21.6 17.3% 0.0% 0.0% 0.0% 1.31sec 56965 10.49sec
DStr_GF_Imp DStr_GF_Imp_eye_of_guldan eye_of_guldan ticks -272131 24009 80 12.00 400 0 27.6 60.0 0.0% 0.0% 0.0% 0.0% 4.71sec 24009 21.19sec
DStr_ID_Felguard DStr_ID_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.00sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 21.06sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard demonbolt 264178 393827 1313 9.42 7110 14219 46.3 47.1 17.6% 0.0% 0.0% 0.0% 5.91sec 393827 300.01sec
DStr_ID_Felguard DStr_ID_Felguard demonic_strength 267171 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.48sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard hand_of_guldan 105174 321470 1072 12.31 4437 8881 61.7 61.5 17.7% 0.0% 0.0% 0.0% 4.80sec 321470 300.01sec
DStr_ID_Felguard DStr_ID_Felguard heed_my_call 271685 42604 142 1.47 4925 9849 7.3 7.3 17.9% 0.0% 0.0% 0.0% 36.88sec 42604 300.01sec
DStr_ID_Felguard DStr_ID_Felguard heed_my_call_aoe 271686 18193 61 1.47 2111 4221 7.3 7.3 17.5% 0.0% 0.0% 0.0% 36.88sec 18193 300.01sec
DStr_ID_Felguard DStr_ID_Felguard inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.58sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard shadow_bolt 686 383111 1277 18.15 3590 7179 91.4 90.7 17.6% 0.0% 0.0% 0.0% 3.21sec 383111 300.01sec
DStr_ID_Felguard DStr_ID_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.55sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard summon_random_demon 0 0 0 0.00 0 0 17.9 0.0 0.0% 0.0% 0.0% 0.0% 13.89sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.19sec 0 300.01sec
DStr_ID_Felguard DStr_ID_Felguard volatile_blood_explosion 278057 87106 290 1.45 10240 20481 7.3 7.2 17.7% 0.0% 0.0% 0.0% 37.11sec 87106 300.01sec
DStr_ID_Felguard DStr_ID_Felguard_felguard demonic_strength_felstorm ticks -89751 238368 795 6.47 6258 12529 5.4 32.3 17.7% 0.0% 0.0% 0.0% 60.72sec 340776 300.01sec
DStr_ID_Felguard DStr_ID_Felguard_felguard felstorm ticks -89751 110199 367 12.12 1545 3090 10.2 60.6 17.7% 0.0% 0.0% 0.0% 30.59sec 157543 300.01sec
DStr_ID_Felguard DStr_ID_Felguard_felguard legion_strike 30213 290280 968 10.65 4633 9266 53.3 53.3 17.6% 0.0% 0.0% 0.0% 5.53sec 414990 300.01sec
DStr_ID_Felguard DStr_ID_Felguard_felguard melee 0 480519 1602 32.24 2533 5064 161.2 161.2 17.7% 0.0% 0.0% 0.0% 1.82sec 686960 300.01sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr melee 0 18609 1556 241.03 329 659 48.0 48.0 17.6% 0.0% 0.0% 0.0% 2.67sec 26604 11.96sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr melee_oh 0 9317 779 241.03 165 329 48.0 48.0 17.8% 0.0% 0.0% 0.0% 2.67sec 13319 11.96sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr shadow_slash 272012 28938 2420 51.98 2372 4747 10.4 10.4 17.7% 0.0% 0.0% 0.0% 12.69sec 28938 11.96sec
DStr_ID_Felguard DStr_ID_Felguard_vicious_hellhound demon_fangs 272013 28709 2229 47.86 2371 4738 10.3 10.3 17.9% 0.0% 0.0% 0.0% 12.93sec 28709 12.88sec
DStr_ID_Felguard DStr_ID_Felguard_vicious_hellhound melee 0 17554 1363 421.25 165 330 90.4 90.4 17.7% 0.0% 0.0% 0.0% 1.43sec 25095 12.88sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend bile_spit 267997 70612 472 2.73 8825 17660 6.8 6.8 17.5% 0.0% 0.0% 0.0% 47.19sec 163204 149.47sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend bile_spit ticks -267997 92592 309 6.66 2779 0 6.8 33.3 0.0% 0.0% 0.0% 0.0% 47.19sec 163204 149.47sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend headbutt 267999 109493 733 12.05 3101 6200 30.0 30.0 17.7% 0.0% 0.0% 0.0% 9.82sec 156533 149.47sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend melee 0 193169 1292 43.21 1525 3049 107.6 107.6 17.7% 0.0% 0.0% 0.0% 2.71sec 276158 149.47sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra melee 0 36806 3596 278.14 659 1317 47.5 47.5 17.8% 0.0% 0.0% 0.0% 2.81sec 52618 10.24sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra melee_oh 0 18366 1794 278.14 329 659 47.5 47.5 17.5% 0.0% 0.0% 0.0% 2.81sec 26257 10.24sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 10.24sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash1 272172 7598 742 45.34 835 1669 7.7 7.7 17.7% 0.0% 0.0% 0.0% 18.52sec 10862 10.24sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash2 272172 7579 740 45.34 834 1670 7.7 7.7 17.4% 0.0% 0.0% 0.0% 18.52sec 10835 10.24sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash3 272172 7590 742 45.34 835 1668 7.7 7.7 17.6% 0.0% 0.0% 0.0% 18.52sec 10851 10.24sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash4 272172 7576 740 45.34 834 1669 7.7 7.7 17.3% 0.0% 0.0% 0.0% 18.52sec 10831 10.24sec
DStr_ID_Felguard DStr_ID_Felguard_dreadstalker dreadbite 205196 210542 1958 16.15 6175 12354 29.0 29.0 17.7% 0.0% 0.0% 0.0% 21.06sec 210542 107.54sec
DStr_ID_Felguard DStr_ID_Felguard_dreadstalker melee 0 455048 4231 173.67 1242 2484 311.3 311.3 17.7% 0.0% 0.0% 0.0% 1.90sec 650545 107.54sec
DStr_ID_Felguard DStr_ID_Felguard_wild_imp fel_firebolt 104318 900668 9401 749.33 640 1280 1201.4 1196.5 17.7% 0.0% 0.0% 0.0% 0.24sec 900668 95.81sec
DStr_ID_Felguard DStr_ID_Felguard_urzul many_faced_bite 272439 22099 1735 49.80 1776 3553 10.6 10.6 17.7% 0.0% 0.0% 0.0% 12.49sec 31593 12.74sec
DStr_ID_Felguard DStr_ID_Felguard_urzul melee 0 36671 2879 222.73 659 1318 47.3 47.3 17.7% 0.0% 0.0% 0.0% 2.72sec 52426 12.74sec
DStr_ID_Felguard DStr_ID_Felguard_demonic_tyrant demonfire 270481 245156 4648 42.71 5548 11096 37.6 37.6 17.7% 0.0% 0.0% 0.0% 6.88sec 245156 52.75sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard melee 0 36557 2949 228.06 659 1318 47.1 47.1 17.8% 0.0% 0.0% 0.0% 2.79sec 52263 12.39sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard melee_oh 0 18268 1474 228.06 329 659 47.1 47.1 17.7% 0.0% 0.0% 0.0% 2.79sec 26116 12.39sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard overhead_assault 272432 20734 1673 47.96 1778 3553 9.9 9.9 17.7% 0.0% 0.0% 0.0% 13.66sec 29642 12.39sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 8.46sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath1 272156 21779 2575 55.43 2363 4731 7.8 7.8 17.9% 0.0% 0.0% 0.0% 17.59sec 21779 8.46sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath2 272156 21675 2563 55.43 2364 4721 7.8 7.8 17.4% 0.0% 0.0% 0.0% 17.59sec 21675 8.46sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror melee 0 36365 4300 332.95 659 1317 46.9 46.9 17.7% 0.0% 0.0% 0.0% 2.77sec 51987 8.46sec
DStr_ID_Felguard DStr_ID_Felguard_darkhound fel_bite 272435 20754 1990 57.10 1778 3552 9.9 9.9 17.7% 0.0% 0.0% 0.0% 13.72sec 29671 10.43sec
DStr_ID_Felguard DStr_ID_Felguard_darkhound melee 0 36501 3500 271.24 659 1318 47.1 47.1 17.5% 0.0% 0.0% 0.0% 2.81sec 52182 10.43sec
DStr_ID_Felguard DStr_ID_Felguard_bilescourge toxic_bile 272167 168552 14174 303.37 2380 4761 60.2 60.1 17.8% 0.0% 0.0% 0.0% 2.06sec 168552 11.89sec
DStr_ID_Felguard DStr_ID_Felguard_eye_of_guldan eye_of_guldan ticks -272131 23941 80 12.02 398 0 27.6 60.1 0.0% 0.0% 0.0% 0.0% 5.44sec 23941 15.72sec
DStr_ID_Felguard DStr_ID_Felguard_prince_malchezaar melee 0 77725 5314 86.62 3123 6241 21.1 21.1 17.9% 0.0% 0.0% 0.0% 1.59sec 111118 14.63sec
DStr_ID_Felguard DStr_ID_Felguard_prince_malchezaar melee_oh 0 38725 2648 86.62 1562 3116 21.1 21.1 17.5% 0.0% 0.0% 0.0% 1.59sec 55362 14.63sec
DStr_ID_Imp DStr_ID_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.96sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.05sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp demonbolt 264178 400485 1335 9.56 7114 14231 47.0 47.8 17.7% 0.0% 0.0% 0.0% 5.82sec 400485 300.01sec
DStr_ID_Imp DStr_ID_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp hand_of_guldan 105174 329493 1098 12.54 4463 8933 62.9 62.7 17.7% 0.0% 0.0% 0.0% 4.72sec 329493 300.01sec
DStr_ID_Imp DStr_ID_Imp heed_my_call 271685 42366 141 1.46 4925 9849 7.3 7.3 17.7% 0.0% 0.0% 0.0% 37.34sec 42366 300.01sec
DStr_ID_Imp DStr_ID_Imp heed_my_call_aoe 271686 18123 60 1.46 2111 4221 7.3 7.3 17.4% 0.0% 0.0% 0.0% 37.34sec 18123 300.01sec
DStr_ID_Imp DStr_ID_Imp inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp shadow_bolt 686 394569 1315 18.67 3593 7187 94.0 93.4 17.6% 0.0% 0.0% 0.0% 3.13sec 394569 300.01sec
DStr_ID_Imp DStr_ID_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.55sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.58sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.19sec 0 300.01sec
DStr_ID_Imp DStr_ID_Imp volatile_blood_explosion 278057 86998 290 1.45 10240 20481 7.3 7.2 17.4% 0.0% 0.0% 0.0% 36.21sec 86998 300.01sec
DStr_ID_Imp DStr_ID_Imp_imp firebolt 3110 940393 3135 20.60 7759 15522 103.8 103.0 17.7% 0.0% 0.0% 0.0% 2.89sec 940393 300.01sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.56sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath1 272156 22116 1631 35.16 2365 4730 7.9 7.9 17.6% 0.0% 0.0% 0.0% 17.25sec 22116 13.56sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath2 272156 22086 1628 35.16 2365 4735 7.9 7.9 17.5% 0.0% 0.0% 0.0% 17.25sec 22086 13.56sec
DStr_ID_Imp DStr_ID_Imp_void_terror melee 0 36906 2721 210.48 659 1319 47.6 47.6 17.6% 0.0% 0.0% 0.0% 2.73sec 52762 13.56sec
DStr_ID_Imp DStr_ID_Imp_vicious_hellhound demon_fangs 272013 29246 2093 45.10 2373 4747 10.5 10.5 17.4% 0.0% 0.0% 0.0% 12.79sec 29246 13.97sec
DStr_ID_Imp DStr_ID_Imp_vicious_hellhound melee 0 17869 1279 394.58 165 330 91.9 91.9 17.7% 0.0% 0.0% 0.0% 1.42sec 25546 13.97sec
DStr_ID_Imp DStr_ID_Imp_vilefiend bile_spit 267997 70988 474 2.73 8823 17648 6.8 6.8 17.8% 0.0% 0.0% 0.0% 47.19sec 163829 149.88sec
DStr_ID_Imp DStr_ID_Imp_vilefiend bile_spit ticks -267997 92841 309 6.69 2776 0 6.8 33.4 0.0% 0.0% 0.0% 0.0% 47.19sec 163829 149.88sec
DStr_ID_Imp DStr_ID_Imp_vilefiend headbutt 267999 109860 733 12.05 3100 6198 30.1 30.1 17.8% 0.0% 0.0% 0.0% 9.82sec 157058 149.88sec
DStr_ID_Imp DStr_ID_Imp_vilefiend melee 0 193647 1292 43.18 1526 3051 107.9 107.9 17.7% 0.0% 0.0% 0.0% 2.71sec 276841 149.88sec
DStr_ID_Imp DStr_ID_Imp_urzul many_faced_bite 272439 21982 1585 45.39 1777 3547 10.5 10.5 18.0% 0.0% 0.0% 0.0% 12.64sec 31425 13.87sec
DStr_ID_Imp DStr_ID_Imp_urzul melee 0 36184 2609 201.71 659 1319 46.6 46.6 17.7% 0.0% 0.0% 0.0% 2.77sec 51729 13.87sec
DStr_ID_Imp DStr_ID_Imp_dreadstalker dreadbite 205196 211503 1956 16.12 6175 12356 29.1 29.1 17.9% 0.0% 0.0% 0.0% 21.05sec 211503 108.11sec
DStr_ID_Imp DStr_ID_Imp_dreadstalker melee 0 455670 4215 172.98 1243 2485 311.7 311.7 17.7% 0.0% 0.0% 0.0% 1.90sec 651435 108.11sec
DStr_ID_Imp DStr_ID_Imp_wild_imp fel_firebolt 104318 912983 10055 801.48 640 1279 1217.8 1212.9 17.7% 0.0% 0.0% 0.0% 0.24sec 912983 90.80sec
DStr_ID_Imp DStr_ID_Imp_darkhound fel_bite 272435 20879 1190 34.07 1779 3555 10.0 10.0 17.8% 0.0% 0.0% 0.0% 12.95sec 29850 17.55sec
DStr_ID_Imp DStr_ID_Imp_darkhound melee 0 36457 2078 160.68 660 1319 47.0 47.0 17.6% 0.0% 0.0% 0.0% 2.66sec 52120 17.55sec
DStr_ID_Imp DStr_ID_Imp_demonic_tyrant demonfire 270481 245794 4652 42.68 5561 11123 37.7 37.6 17.6% 0.0% 0.0% 0.0% 6.88sec 245794 52.83sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr melee 0 18594 1461 225.65 330 660 47.9 47.9 17.8% 0.0% 0.0% 0.0% 2.65sec 26582 12.73sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr melee_oh 0 9281 729 225.65 165 330 47.9 47.9 17.6% 0.0% 0.0% 0.0% 2.65sec 13268 12.73sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr shadow_slash 272012 28930 2273 48.80 2375 4753 10.4 10.4 17.6% 0.0% 0.0% 0.0% 12.50sec 28930 12.73sec
DStr_ID_Imp DStr_ID_Imp_wrathguard melee 0 36560 3322 256.62 660 1320 47.1 47.1 17.7% 0.0% 0.0% 0.0% 2.76sec 52267 11.01sec
DStr_ID_Imp DStr_ID_Imp_wrathguard melee_oh 0 18273 1660 256.62 330 660 47.1 47.1 17.7% 0.0% 0.0% 0.0% 2.76sec 26123 11.01sec
DStr_ID_Imp DStr_ID_Imp_wrathguard overhead_assault 272432 20825 1892 54.15 1779 3557 9.9 9.9 17.9% 0.0% 0.0% 0.0% 13.45sec 29771 11.01sec
DStr_ID_Imp DStr_ID_Imp_bilescourge toxic_bile 272167 173825 15490 331.67 2383 4765 62.1 62.0 17.6% 0.0% 0.0% 0.0% 2.02sec 173825 11.22sec
DStr_ID_Imp DStr_ID_Imp_shivarra melee 0 36313 2548 197.19 660 1319 46.8 46.8 17.5% 0.0% 0.0% 0.0% 2.70sec 51913 14.25sec
DStr_ID_Imp DStr_ID_Imp_shivarra melee_oh 0 18181 1276 197.19 330 660 46.8 46.8 17.7% 0.0% 0.0% 0.0% 2.70sec 25992 14.25sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 14.25sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash1 272172 7531 529 32.25 836 1672 7.7 7.7 17.6% 0.0% 0.0% 0.0% 17.53sec 10766 14.25sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash2 272172 7509 527 32.25 836 1670 7.7 7.7 17.3% 0.0% 0.0% 0.0% 17.53sec 10735 14.25sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash3 272172 7540 529 32.25 836 1671 7.7 7.7 17.8% 0.0% 0.0% 0.0% 17.53sec 10780 14.25sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash4 272172 7532 529 32.25 836 1672 7.7 7.7 17.6% 0.0% 0.0% 0.0% 17.53sec 10767 14.25sec
DStr_ID_Imp DStr_ID_Imp_prince_malchezaar melee 0 76621 3573 58.46 3125 6262 20.9 20.9 17.3% 0.0% 0.0% 0.0% 1.63sec 109539 21.44sec
DStr_ID_Imp DStr_ID_Imp_prince_malchezaar melee_oh 0 38248 1784 58.46 1564 3121 20.9 20.9 17.2% 0.0% 0.0% 0.0% 1.63sec 54680 21.44sec
DStr_ID_Imp DStr_ID_Imp_eye_of_guldan eye_of_guldan ticks -272131 24280 81 12.18 399 0 28.1 60.9 0.0% 0.0% 0.0% 0.0% 5.34sec 24280 11.42sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
135840.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 13.23% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.27% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.27%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.84% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.31% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.85% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.04% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 13.03% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:13.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.19%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 4.35% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.88% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your $?c1[Chaos][Fire] damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 135840.17
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 4999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 4999
Mean 138153.92
Minimum 129968.70
Maximum 148174.87
Spread ( max - min ) 18206.17
Range [ ( max - min ) / 2 * 100% ] 6.59%
Standard Deviation 3179.8462
5th Percentile 133547.89
95th Percentile 144160.68
( 95th Percentile - 5th Percentile ) 10612.79
Mean Distribution
Standard Deviation 44.9743
95.00% Confidence Intervall ( 138065.77 - 138242.07 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2036
0.1 Scale Factor Error with Delta=300 86317
0.05 Scale Factor Error with Delta=300 345268
0.01 Scale Factor Error with Delta=300 8631692
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1290
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 32523804 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3336 3336 3336
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n